Home 

Gene Symbol:  
nocG
Organism:  
Nocardia sp. ATCC 202099
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
30980..32875 [-1], 1896 bp
Product Function:  
cyclodehydratase
Product Locus:  
 ADR01083.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosG in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:1896 bp
>nocG|ThioFinder135 Nocardia sp. ATCC 202099
ATGGCGGCCCCGCAGGTCGCGGGCACCGGCTTCCTCGCCGACGAGCTGGGCAGGCGGCTCTCCGCCGACC
CGCCCGCGGGCGTCGACACCGTGCTGGTCGCCGAGCTGGACCGCATCGGCGAGCACCACGACCTGATCGT
GGAGTGCTTGGGCACTGGCAGGCCGCTGCTGTTCGTCGGCACCTACCGCTCGCTGGTCTACATCGGACCG
CTGTGGGCGAGCCGGGTGCCGGGGTGCCCGCACTGCCTGGTCACCCGCACGGCGAACTCGCCGTTCGGCC
CGGACCTGCGCGGCGACACCGCCCCGGAGTCCTCGCGGCGCGACACCGCCACGTTCACCCTCGGGCCGGG
CGTGCTGGCCGCCGTCGAGCGGCTGGTGCGCGAGCGGATGGCCGACAGCGGTCCGGACGGCCCTGGCAGC
CCGGACTGCGAGGTGACCGTGGTCGACGGCGTGACGGCGACCGTCGACCGGCAGGTGCTGCTGCCCGACT
CCACCTGCGCGAGCTGCGGCGGGGCCGAGGCGGACACCGTGCCGGTGTTCACCCCGAGGGAGGTGCCGCT
GCCCAAGCTCGGCCCGCGCTCGCTGCGCACCGCCGAACTGGACGCCGACACCGTCGCCAAGGACTACCTG
TTCGCCGGGATCGGGCTGTTCAAGGAGGTCCGCCAGGACCTGCAGAGCCCAATCGGCGCCTGCTCGGTGG
AACTGGGCACCCGGTGGGGCAGGCGCGAGCCCGCCATCGGCCGGGGCCGCACCTACCGCAGCAGCCGCAC
CATCGCCGTCCTGGAGGGCCTGGAGCGCTACGCCGGGCTGCACCGCGGCGGCCGGAGCGCCCCGGTGCGG
GCCTGCTACGCCGACGTCGCCGACCGGGCGATCGACCCGACGACGCTGGGCACCCACCCCGAGGCGTCCT
ACGCCGAGCCGGGCTTCCGTTTCCGCCGGTTCGACCGGGACACCGTCGTGGACTGGGTGTGGGCGTACTC
GATGCGCCGCGGCGAGCGGGTGCTGCTGCCGGAGCGGGCCGCGTTCTGGGGCCCCCGCCACGACGGTGAG
ACCGCGTTCCTCTACGACACCTCCAACGGCTGCGCGCTCGGCAACTCCGCGGAGGAGGCCGTGCTGCACG
GGCTGCGCGAGGTCGCCGAGCGCGACTCGTTCCTGATGGCCTGGTACCGCAGGCTCGCCCTGCCCGAGAT
CGACATGGTGGGCGCGGACGCCGGGCTGGACGCGCTGCTGCGCAAGGCGGAGCTGTTCACCGGCTTCCGC
TTCCGGGCTTTCCTGTCCACTATGGAGTATCGAATGCCGTGTACCTGGCTCGTCGCGGAGAGCAGGCTCG
ACGACGGGCCGCGCGTCTTCGCCGGAGCCGGGGCGCACCCGGACCCGGTGCAGGCCATCGCGGGCGGTCT
GCACGAGCTGATCGGCAGCGTGCTCGCCACCCGGCACTCCTACGAGCGCAGGCGCGCCGACGGGCTGGCC
ATGCTCGCCGACCCGGCGCTGATGACCAGGATGGAAGACCACTCCCTGGTCGGCGCGCTGCCCGAGGCCC
GCGAGCGCTGGTCGTTCCTGCTGGACGCGGATGCGGGGCGGGTCGCCCTGGCCGACGTGCCCGGCACGCT
GCGCGAGCGCGAGCCCGACCTGCGCGCCGACCTCGACGTCGCCGTGTCCGGCGTGCTGGCCGCGGGCATG
GACGTGCTCGTGGTCGACCAGACCATGCCAGAACTGCGCCGCAACGGCCTGACCTGCGTGCGGGTCGTCG
TGCCCGGCGCGGTCCCGATGACGTTCGGCCACCGCAACCGGCGCACCCGCGACCTGCCCCGCCTGGCGGG
CGGCGCGGGACTGCCCTACCGGTCCGGACTGGTCGACGGGGAGGAGCCGGGATGCGTGCCGCACCCGTTC
CCATGA
 Primer design

Protein Sequence:631 a.a.
>NocG|ThioFinder135 Nocardia sp. ATCC 202099
MAAPQVAGTGFLADELGRRLSADPPAGVDTVLVAELDRIGEHHDLIVECLGTGRPLLFVGTYRSLVYIGP
LWASRVPGCPHCLVTRTANSPFGPDLRGDTAPESSRRDTATFTLGPGVLAAVERLVRERMADSGPDGPGS
PDCEVTVVDGVTATVDRQVLLPDSTCASCGGAEADTVPVFTPREVPLPKLGPRSLRTAELDADTVAKDYL
FAGIGLFKEVRQDLQSPIGACSVELGTRWGRREPAIGRGRTYRSSRTIAVLEGLERYAGLHRGGRSAPVR
ACYADVADRAIDPTTLGTHPEASYAEPGFRFRRFDRDTVVDWVWAYSMRRGERVLLPERAAFWGPRHDGE
TAFLYDTSNGCALGNSAEEAVLHGLREVAERDSFLMAWYRRLALPEIDMVGADAGLDALLRKAELFTGFR
FRAFLSTMEYRMPCTWLVAESRLDDGPRVFAGAGAHPDPVQAIAGGLHELIGSVLATRHSYERRRADGLA
MLADPALMTRMEDHSLVGALPEARERWSFLLDADAGRVALADVPGTLREREPDLRADLDVAVSGVLAAGM
DVLVVDQTMPELRRNGLTCVRVVVPGAVPMTFGHRNRRTRDLPRLAGGAGLPYRSGLVDGEEPGCVPHPF
P