Home 

Gene Symbol:  
nocH
Organism:  
Nocardia sp. ATCC 202099
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
32902..34683 [-1], 1782 bp
Product Function:  
hypothetical protein
Product Locus:  
 ADR01084.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosH in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:1782 bp
>nocH|ThioFinder136 Nocardia sp. ATCC 202099
ATGAGCGCCGACACCCGCTGCTTCGCCGTCAAGGCCGACGCGTTCTTCGTCCGCCACGACGACGGCGTCT
GGCTGCGCAACGACCACGGCTCCTTCTCCATCCGGGGCAAGGGCGCCTACGAACTGGTGGAGACCGTGTT
CGCCCACCTCGACGGCGAGCGCAGCGTCGCCGACCTGTGCGCCGGGCTGCCCGACGGCCCGAGCCGCTCC
GTCGCCCGGCTGATCGACACGCTGGCGGGCAACGGCTTCCTCAAGCGCGTGGAGCACCCGGTCGAGCACG
CCCCCGACTGGATGCGCGAGCGCTACCCGGCCCACCTGGCGTTCCTCGACCACCACGCCGACCGGCCGGT
CACCAGGATGACCAGGGTGCGGACCCGCCCGGTGCTCGTCGGCGGCTCCGGGGTGGCGCTGCGCGCCGCG
CTGGACGCGCTGGCCGAGTTCGGCATCGCCACCGCCAGGATCGTCTCCACCGATCCCGAGGCCGCCGTCG
TGGTCGCCGAGGCGGCCGAGCGCGACCCGCACCTGGCCTGGACCCTCGACCACGCCGACCTGGCGGCGTT
CGCCGAGTTCCCCGACACCGACGAGGTCGTGCTGGCCGTCGACGACGCCGACCCGGCCGCCCTCGCCGAC
CTGCAGTGGCGGCTGCGCGCCACCGGCAGCCCGGTCGCCGTGCTCGCCACGGTCTCCGGCTACCTGGTGG
CCGCCGCGCCGCCGTCCGGAGTGGACTGGTGCTGGGAGTGCGTGCACCGCTCGGTCGTCGCGGCCCCCGT
CGGCGGGGCCACCGGGCTGGCCCCGGCGGCGACCCCGGCCGCGCTGGCCGCGCTGCACGTCGCCCAGCAC
GTCTTCGCCCGCCTCGCCGAGGTCGACCTCGACGGCGCCGGGCTGCTCACCTCGGCCGAGCCGCTGGCCC
CGGTGGTGCGCACGCACACCGGCAGGCGGCACCCGATGTGCAGGCGCCACGGCGCGGCGACGGCCGCGGT
GGTCGAGCGGGTCGAGCCGGTGCGCCCGGACGTCCCGGCCCCGCAGGACCCGCCGCGGCTGACCGCGGTG
TCCGACCGGATCGTCGGCGCCACCGCGGGCTGGACCGACCAGGTGGTCGGCCCGCTGCTCTCCCTCGGCG
AAGGCGAGGCAGACCAGCTCCCGCTCTCGGCCAGCACCTGCCTGATCGCCGACCCGGTGGAGCGCGCCAG
CAGGCTGCTCGTCTGCCGCGCGGTGTCGCCGCGGGAAGCGCGCAACCAGGTCGTGCTGGCCGCGCTGGAG
TGGACCGCTGGCAGGCTCGCCGACCACGGCGTCGGCCCGGCGGACGCGGCCTGGGGAGCGGGCTGGACGT
CGGCGGAGGCGTGGTACCGGGCGGTCGCCGCGGCCTCGCTCGCCCTGCCGCCTGCGTCGCTGAGCTGGCA
GTCCGCCGAGCCGCACGGGGCTGACCCCGTGCACGGCTTCCTCACCGACACCCTCGCCGCCGAGGGACGC
CCGTGGACGGCGACCGCGCTGGAGGCGCTGCCCACCGGCCTGCACCGGGCGCGGGTGCGCACCGCGGACT
TCGAGGTCGCCGAGGGCGTCGGCATCGACGCAGCGCACGCCGTCGGCAACGCGCTGCTGCGCGCCGTCGC
CGGGCGCGGCGACGCCGTCGCCCACCTGGCCCCACCGGTCGCCACCTGGCCGGAGGCGGTCGCCGCGGTC
CGCGCCCAGGGCCGCCCGCCCGAGCCAGCCGACGTGACCCACCTGCTGCCGTTCCTCGGCGACGCCGCGT
GCCTCGCCGCCATCCCGGGAGGTGCCCGGTGA
 Primer design

Protein Sequence:593 a.a.
>NocH|ThioFinder136 Nocardia sp. ATCC 202099
MSADTRCFAVKADAFFVRHDDGVWLRNDHGSFSIRGKGAYELVETVFAHLDGERSVADLCAGLPDGPSRS
VARLIDTLAGNGFLKRVEHPVEHAPDWMRERYPAHLAFLDHHADRPVTRMTRVRTRPVLVGGSGVALRAA
LDALAEFGIATARIVSTDPEAAVVVAEAAERDPHLAWTLDHADLAAFAEFPDTDEVVLAVDDADPAALAD
LQWRLRATGSPVAVLATVSGYLVAAAPPSGVDWCWECVHRSVVAAPVGGATGLAPAATPAALAALHVAQH
VFARLAEVDLDGAGLLTSAEPLAPVVRTHTGRRHPMCRRHGAATAAVVERVEPVRPDVPAPQDPPRLTAV
SDRIVGATAGWTDQVVGPLLSLGEGEADQLPLSASTCLIADPVERASRLLVCRAVSPREARNQVVLAALE
WTAGRLADHGVGPADAAWGAGWTSAEAWYRAVAAASLALPPASLSWQSAEPHGADPVHGFLTDTLAAEGR
PWTATALEALPTGLHRARVRTADFEVAEGVGIDAAHAVGNALLRAVAGRGDAVAHLAPPVATWPEAVAAV
RAQGRPPEPADVTHLLPFLGDAACLAAIPGGAR