Home 

Gene Symbol:  
nocO
Organism:  
Nocardia sp. ATCC 202099
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
39973..40914 [1], 942 bp
Product Function:  
hypothetical protein
Product Locus:  
 ADR01090.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosO in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:942 bp
>nocO|ThioFinder142 Nocardia sp. ATCC 202099
ATGACCTGGACGGAACTGGTCTTCCCGGCGACCCAGGACGAGCAGCCCGGCCTGGTCGCCGGGGTGCTCG
CCCCGCTGCTGGCCGACCTCGACCGCCCCGGCCTGTTCCTGCGCGAACTCGGCCCCGAGGGCGCCACCCG
ACTGCTGCTCCAAGTCCGCGACGCCCCACCGGACCTGCCGACCAGGACCGCGGCCCTGCCCGTGCAGCCG
ACGGCCGTGCGCGCTGCCACCGTCGCCCCGCTGGGCGGCCCGGTCTTCGACGGCCCCGGCCTGGACGAGA
CCACCCGCGGCTTCCTGGCGGACACCGCGCCGGTGGCCGTCGACCTGTCCACCCGCCCCGACCGCACCGG
CGCGGCCCTGACCCTGATGACCGCCCACCTCGCCGCGGTGGCCGACCCGGCCCGCTCCGGCGACGGCCCT
CCGCTGAGCTTCCTCAGCTTCCGCTCCCACGCCGAGGCGTTCCTGGCCACCACCCGCGACCCGAACGCCG
CCCGGCACGCCTTCGACACCCGCTACACCGACCACCGCACCACCGTCGAAGCCGCCGTCCGGGCGATCCT
GCTCGACGGCGACCCTGGCGACGCCGCGCCCTGGTCCGCCGCGGCCCGCGCCGCGAAACCCCGGTTCACC
GCGGGCTTCGCCAGCGCGGACCTGGTCGCCCACACCGGCTACACCCGCGACCACCTCCGGGAACGCACGG
ACTTCGCGGACAACCCGTTCCACAGCAGGGCGGGCGCGTCCGAGCAGCTACAGGCGTACCTGGGCGGCGA
CCCGTCATTCCTGGCGACCCGCCTGCTCACCAGCCTGCTCTACGTGACCCTGCACTCGTCGGGGGTCAGC
CTGATGCAGCGCTACTTCCTCTGCCACGCCATAGCCAAGGCCTGCGAGTCGATCTACCACGTCGACAGCA
TGAGCCTGCTGGCAGACCTGGCGGTCGGGTAG
 Primer design

Protein Sequence:313 a.a.
>NocO|ThioFinder142 Nocardia sp. ATCC 202099
MTWTELVFPATQDEQPGLVAGVLAPLLADLDRPGLFLRELGPEGATRLLLQVRDAPPDLPTRTAALPVQP
TAVRAATVAPLGGPVFDGPGLDETTRGFLADTAPVAVDLSTRPDRTGAALTLMTAHLAAVADPARSGDGP
PLSFLSFRSHAEAFLATTRDPNAARHAFDTRYTDHRTTVEAAVRAILLDGDPGDAAPWSAAARAAKPRFT
AGFASADLVAHTGYTRDHLRERTDFADNPFHSRAGASEQLQAYLGGDPSFLATRLLTSLLYVTLHSSGVS
LMQRYFLCHAIAKACESIYHVDSMSLLADLAVG