Home 

Gene Symbol:  
tsrO
Organism:  
Streptomyces laurentii ATCC 31255
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
20576..22621 [1], 2046 bp
Product Function:  
cyclodehydratase
Product Locus:  
 ACN80677.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosG in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:2046 bp
>tsrO|ThioFinder157 Streptomyces laurentii ATCC 31255
ATGAGCGCGCCGCCGACGACGGCACCCCACGCGCCCGAGGGCGTCGACGACACGGCGGCCGAGCTGCGCC
GTCTGCTCGACGACGTCGCCCGGGTCGTCGACACCCCGGCCGCGATCACCGCCGCCGCCCCTCTCCACGC
CGGCCTCCCCGCCGAGGGGGACGGCCGCCCGGTCGTCCTGGTGAACCTCGGCTGGGACGCCGACCTGTCC
GGCCTGCCCGCCGCGGGCACCACCGTGCTGCCCGTGTACGGGCTCCGCGGCCGCGTCGTCGTCGGCCCGG
TGACCCGACCCGGACTGCCCGGCTGCCCCCACTGTCTGGGGCTGCGCGTGCGCGCCACGGACCGCCCCGA
GGGCGTCCCCCGGGGCGAGCCGGCCGTCCCCCGCCGGCTGTCCGCGCGGCCCGACGCGTGGCTGCCGCCG
GGGACCGCGCGCCTGGTGGCGGCCGTCGTCCGCGCCGAACTGGCCCGGCTCGCCGCCGGTGAGCCGCCGC
TCGGCACCGAGGCCGCCTACACGGTCGGGCCCGCCCGGCTGGCCGGCGACTGGCATCCGGCGCTGCCGCA
CACCCTGTGCGACACGCCGCACTGCCGGGGCGCCCGCCGCCCGCTGCCGCCCCCGCTCCCCGACCTGGCC
ACGCCGCTGCCCGCGACCGGTGTGGGCTCGGCCCGCCGCTTCCCGGCCGCCCGGTTCGCCGAACGGCTGG
AGCGGGAGTACCTCGACGGCTGGTCGGGCGTCACCCGCTCCGCCGCCGTCGGCGACCGGGCCGTCCTGCC
GTCGACGCAGGTGCGGGTGCCCACGGTCTGGGGGTTCGACGAGATCGCGATCGGCCGCGCCGAGGACTAC
GCGGGCGCGCGCCCGGCGGCGATCCTGGAGGGGCTGGAACGGTACGCCGGCTGGCACTGCGGCGGCCGCG
ACCCCGTCCGCTTCGCCTCCTACGCCGAACTCGCCTCCGCCGACGCCGCTGAGCCCTCCGGCGGACCCGG
CGGGCCGGACCGACCCGCCGCCTCCGACGCCGTCGTCGATCCCCGCTCCCTGCTCCTGCACCCCGAAGAG
GCGTATGGACAACCGGGGTTCGAGTACACGCCGTACGCCCCGGAGATCCCGACCGGATGGGCGGAGGCGT
ACTCCGCGCTCACGGGCCGGCGGACCCTCGTGCCGTTCCACGTCGCGTACTACGGCGCGACCCGCCGCCC
CGAGACCGGCCCGCGCTTCGTCTACGAGAACTCCAACGGCTGCGCCCTCGGCTCCGGCACCGAAGAGGCG
CTCCTGGCCGCCCTGTTGGAGGTGTCCGAGCGCGACGCCTTCCTGTGCGCGTGGCTCTCCGGGACGCCGC
TGCCGGAGATCGACCTCGGCCGGCTGACCGGCGAGGCGGCGCGGGCGGTACGAACGGTGCGCCACCGCAC
CGGCCGCGAGCTGCGGGCCTTCCGGGCGCTGGGCGCCTTCGACGTCCCCGTGGCCCTCCTCGTGTCGACA
GCGGAGGATCCGGACCTGCCGGCGACCCTGGTCACCGCCGGCTCGGGCCTCACGGTGGAACGGGCGCTGC
TCGGCGCCGTCCACGAGATGGCCGCCTCCGCACCCGTGAACACGGTCGAATTCCAGCGCCGCCGGGCCGA
GTTGGAGGCGGCACTGGACGATCCCGGGCTGGTCCGCCGGATGGAGGACCACGCGCTGGTGGGCGCCCTG
CCCGAGGCGCGCCCGTGGTTCTCCTTCCTCCTCGACGGCACCCCGCCGGGCGTGCCCGGCCCGGCCGCCC
CGGACGGCCTCACGCCGTCCGGCGACGTCGCCGCCGATCTCGCCGCGATGCTCGCGGCCGCGCGGCGCGA
CGGGCAGGACGTCGTCGTCGTGGACCACACCACCAGCGAGCTGGACCGCCTGGGCCTGCGCTGTGTGAAG
GCGATCGTGCCCGGCACGGTGCCGATGACCTTCGGCCACCGGCACCGCCGGCTGCCGCCGCCCGCGACGC
TCCGCGCGTTCCGGGCCCGGCACACCGACGGCCCCGTCGAGTTCTCCCCCGAGGAAGTACGGCATGAGCC
ACACCCGTTCCCCTGA
 Primer design

Protein Sequence:681 a.a.
>TsrO|ThioFinder157 Streptomyces laurentii ATCC 31255
MSAPPTTAPHAPEGVDDTAAELRRLLDDVARVVDTPAAITAAAPLHAGLPAEGDGRPVVLVNLGWDADLS
GLPAAGTTVLPVYGLRGRVVVGPVTRPGLPGCPHCLGLRVRATDRPEGVPRGEPAVPRRLSARPDAWLPP
GTARLVAAVVRAELARLAAGEPPLGTEAAYTVGPARLAGDWHPALPHTLCDTPHCRGARRPLPPPLPDLA
TPLPATGVGSARRFPAARFAERLEREYLDGWSGVTRSAAVGDRAVLPSTQVRVPTVWGFDEIAIGRAEDY
AGARPAAILEGLERYAGWHCGGRDPVRFASYAELASADAAEPSGGPGGPDRPAASDAVVDPRSLLLHPEE
AYGQPGFEYTPYAPEIPTGWAEAYSALTGRRTLVPFHVAYYGATRRPETGPRFVYENSNGCALGSGTEEA
LLAALLEVSERDAFLCAWLSGTPLPEIDLGRLTGEAARAVRTVRHRTGRELRAFRALGAFDVPVALLVST
AEDPDLPATLVTAGSGLTVERALLGAVHEMAASAPVNTVEFQRRRAELEAALDDPGLVRRMEDHALVGAL
PEARPWFSFLLDGTPPGVPGPAAPDGLTPSGDVAADLAAMLAAARRDGQDVVVVDHTTSELDRLGLRCVK
AIVPGTVPMTFGHRHRRLPPPATLRAFRARHTDGPVEFSPEEVRHEPHPFP