Home 

Gene Symbol:  
sioK
Organism:  
Streptomyces sioyaensis ATCC 13989
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
22193..23197 [1], 1005 bp
Product Function:  
dehydrotase
Product Locus:  
 ACN80648.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosD in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:1005 bp
>sioK|ThioFinder175 Streptomyces sioyaensis ATCC 13989
GTGAGTACCGACACGGCGCACTCCTGGCTGTCCTGCCACGTCTTCCACCACGGCGACACCGATCCGTTGC
TCACGGATCTCCTCCTGCCCATGGTCGACGAGCTGCGCGGCGCGGGACGCCTGGAGCGCCACTTCTACCT
GCGCCACTGGGAGCGCGGTCCGCACGTCCGGCTCCGGATGCAGGTGCCGGCCGAGCAGCACGACGACGTC
CGGGCCCAGGTCGAGCGCCGGATCGTCGACCACCTGGAGCGGCATCCCGGCCCCGCCGATACGGATCCGG
TGCGGCTGCGGGATGCGCTCCGCCACCTCAGCGAGCTGGAGCACGGTGACGCCTCCGACGCCCTCATGCA
GACCCCGGAACCGCCGAACACGGTCCGCTGGATCGACTACCGGCCCGAGACGGCCAAGTACGGCGGGCCG
GAAGGCGTCGAGATCGCGGAGGACGTCTTCCACGCGAGCTCGCTGCTGACCGGACAGGTGCTCCGGCTGG
TCCGCAACGACCGGGCGCGCCTGGGGATCTCCCTCCAACTGCTGCTCCTGGCCTCGCGGGCGCTGGGTTT
CGGGCCGGACGACCGCGCCCTCTTCCTCCGCACCTACCACGAGCGCTGGGCCGCGTACGTCTCGGACGAC
CGCCTGCTGGCCGCCTGGAACGAGCAGTACCGGCTGCAGCGCGCGGACTACGCGAAGCTGATCGCCGGCC
TGGACACCGGCGAACCCATCGGCAAGGGACTGGGCGAGCGGTGGGAGCGCACGCTCGTCCAGTCCCTGGA
GCGGCTGCGCCCGCTCGTGGCGGCAGGGCGGGTGTGGCCGGCGGAGACCGACCGCTCGGCACCCCCCGTG
GTCGCGCTCGCGACCCTCGTCAGCCAGTACCTCCACACCACCAACAACCGGATGAACGTCCGCCCGCAGG
GCGAATGCTTCGTCGCCTACCTGGCCTGCCGGGCGGCGGAGGAGCAGGGCGCGAGCCAGTCTCGCCCGGT
GCCGGCCGCACAACGACAGGGATGA
 Primer design

Protein Sequence:334 a.a.
>SioK|ThioFinder175 Streptomyces sioyaensis ATCC 13989
MSTDTAHSWLSCHVFHHGDTDPLLTDLLLPMVDELRGAGRLERHFYLRHWERGPHVRLRMQVPAEQHDDV
RAQVERRIVDHLERHPGPADTDPVRLRDALRHLSELEHGDASDALMQTPEPPNTVRWIDYRPETAKYGGP
EGVEIAEDVFHASSLLTGQVLRLVRNDRARLGISLQLLLLASRALGFGPDDRALFLRTYHERWAAYVSDD
RLLAAWNEQYRLQRADYAKLIAGLDTGEPIGKGLGERWERTLVQSLERLRPLVAAGRVWPAETDRSAPPV
VALATLVSQYLHTTNNRMNVRPQGECFVAYLACRAAEEQGASQSRPVPAAQRQG