Home 

Gene Symbol:  
sioJ
Organism:  
Streptomyces sioyaensis ATCC 13989
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
19548..22196 [1], 2649 bp
Product Function:  
dehydrotase
Product Locus:  
 ACN80647.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosE in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:2649 bp
>sioJ|ThioFinder174 Streptomyces sioyaensis ATCC 13989
ATGTCTAGGCCGGGGATCAGGTACGCCGGATACGGCGTGGTGCGCGTCTGCTCGCAGCCGGTCGATGTCG
TGGCGCAGCTCTCCTCGCGCGAGGTCGCCCGCCTCTGCGACGAGCTCAGGGAGCTGCGGCGCGACTGGCA
GGACCGGGCGCCGCGGGTGGCGGAGGAACTCACCTCGCTGGTACCGGACCTGACCGATCGCGAGCAGCGC
CGCGCCGTGCTCGCGCTGCGCCGGCGCCTGCACCGCGCGGCGGACGTGCCGGCGGCCGCGCTCGACGTCC
TCCACCTGCCCGGTGGGGCCGACGTGGCCGGTGCCGCGGAGCTGCGTGCCCTGGCCGCTGCGCGCGACGA
CCTCACCGCCCGGTGGGAGGACGCGTACGAGGCGGCGCTCCGCGCGGAGCAGAAGGTGCTGGCCTCCGCG
GCCCTGGACCGCTCCCTGCGCGCGGGTGCCCAGCTGAGCGCGGACGGCCTGCTGCACAACATGGACCGTT
ACGCCGCCGCGGTCGCCGACGGCACCGCGCACGGCAAGCGGGACCGGATGACCGAGTCCACCGTGCTCAA
TCTGCTGACGCGGAGCGCCCTCAAGCCGTCCCCCTTCGGCCAGTTGGTCCGCACCCAGCCGGTGCTCCTC
CAGGAGCGCGCGGCGGCCGAGGCGCCCTCCGCCGAGCTCGACGCGGACGCGCAGGTGTCCGTCTGCCGGC
TGCCCCGCCAGCTCGTGAGCTGGGTGGAACGCTCGCTCGCCGACCACCCCGCGTTCCGGTCCGCGGCGGT
TCTCCGCCGGGCACCGGTGGTGGGATCGTCGAGCGAGGGAGTCGTCTTCCTCCTCCGGGGCCGGGACGGC
ACCCACGAGCCGGCCGCCAAGGAGCGGCTCGTGCGGGTCCCGTCCAGCACGGTGGTCACGGAACTCCTCG
CGCTGTCGGCGGACTTGGCGGTACCCGAGCGGGACGTGCGGGCACGGTGCGCCGCGCTTCCCGACACGGA
TCCGGCCGCCGCGCACACCGCGCTCGACACGCTGATCGAGCAGGGCGTGCTCGCCCGCGACCTGGGGGTG
GGGGACCAGCACCCGCACCCCATCGCGCGGCTGGTCGCCTTACTTCCCCAGGACTGCGACGCCGGCCTCC
GGGAGTGCGTGGACCGGATGGCCGCCGCCGAGTCCGCGTTCGAGACCGCCGGGCTCGACCGGCGGGAGGA
GCTCATCGCCCAGATCAAGCGGCAGGTCGCCGAGGTCGCCGACCGGTGCGGGGTCGCCACCCCACCGATC
GAGGCGGCACGCACGCTCCTGTACGAGGACACGGTGGTGGCCACGCCACGCACCGAGCCCGCCGACCGCT
GGCAGCGGCACCTGCCCGCCCTGTCCCACTGGCACCGGCTGCTTCCGCTCTTCGACGACGCCGCCCACGT
CCGGGCGATCGTCGCCGACGTGGTCAGGACGCGGTTCGGCCCCGGCCCGCACCGGCTCCTCACCCTGTTC
GCGGCGCTGTCCTCGGCCAAGGTGCAGCTGCTGCTCACCCAGCGGCTGACCGATGTCTCCGCCCCGATGC
CGACGCAGCTGCGCACCCTCCAGGACGCGGTGTACGAGCTGGCCCGCCCGGAGGACGGCGCCGAGACGGT
GATCGATCCGCAGCGGGCCGCGGAGCTCGCCGAGAACCTTCCGCCGTGGATACCCCGGTGGTCCCGGGCG
AGCTGGAGCGTGCAGCACGATGCGTCCCCCGACGGCGGGCTGCTCGTCGTCAACGGCGGTTCGATCGGCT
TCGGACGTGCCATCTCACGGTTCCTGCCCTCCTACGCCGCGGTCGGTGACGGCGGATTCGGCGAGCTGGT
CCGGGCGGAGATCGCCCAGGACGACCGCACCTCCGCGCCGCTCACCGATCTCTCGGCCGTGCTCGGCATC
AATGCCAATGTGCACTCCCCGCTCCTGGGCAGCTACCTCCGCTACCCCTGCGCGACCCCGGAGGAGTGGG
GCCAGGACCCCGGCGTCTCCCTGGAAGAGTGCTGGGTCGAGTGCGACGAGGGCACGGGCCGGCTGCTGCT
CCGCCGGGGCAAGGACGGCCCGCCCCTGCGGCTGGTGATGCTGAACTTCCTGCTCAACGAACTCGCGCCG
CGCTTCTACCAGTTCCTCAACTTCTTCGGCGCGGGCAGCCTGGCCAACCTCGCCTGGTGGGACCGGGTCG
ATCAGCGCCGGGGCGACCCGCACACCGTCCGCCGGTACCCGCGGGTCCGCTCCGGGAGCCTGGTCCTGGC
GCGCCGGACCTGGAAGGTTCCCGCCGACCGGCTCCCGGACGTCGCCACCGGGAACGGCGCCGACGCATTC
GCGGAGGTGCGGCGCTGGCAGGAGTCGCTGGGGCTCCCGGACCGCGTCTTCTACCGCGGCTTCACCCTCC
CCGATCCGCTCGTCCCGACGTCGGAAGAGGAGCAGCACACCTGGGCGAGGACGCTCGCACGTTTCCCGAC
CTCGGCCGAACGCAAGCCCACCTTCCTGGACTTCACCAGTGTCACCAGCGTGCGCGCCTGGCAGCGGGCA
CTGCGCCGGTGCCAGGGCGACCTGACGTTCCAGGAGTGCCTGCCGACGGTGGGCGACGACGGTGCACAGG
GCCACCGCGAGCGGCTCACCGAGGAGTTCATCATCGAGACCACTGAGGGGGCACGGTGA
 Primer design

Protein Sequence:882 a.a.
>SioJ|ThioFinder174 Streptomyces sioyaensis ATCC 13989
MSRPGIRYAGYGVVRVCSQPVDVVAQLSSREVARLCDELRELRRDWQDRAPRVAEELTSLVPDLTDREQR
RAVLALRRRLHRAADVPAAALDVLHLPGGADVAGAAELRALAAARDDLTARWEDAYEAALRAEQKVLASA
ALDRSLRAGAQLSADGLLHNMDRYAAAVADGTAHGKRDRMTESTVLNLLTRSALKPSPFGQLVRTQPVLL
QERAAAEAPSAELDADAQVSVCRLPRQLVSWVERSLADHPAFRSAAVLRRAPVVGSSSEGVVFLLRGRDG
THEPAAKERLVRVPSSTVVTELLALSADLAVPERDVRARCAALPDTDPAAAHTALDTLIEQGVLARDLGV
GDQHPHPIARLVALLPQDCDAGLRECVDRMAAAESAFETAGLDRREELIAQIKRQVAEVADRCGVATPPI
EAARTLLYEDTVVATPRTEPADRWQRHLPALSHWHRLLPLFDDAAHVRAIVADVVRTRFGPGPHRLLTLF
AALSSAKVQLLLTQRLTDVSAPMPTQLRTLQDAVYELARPEDGAETVIDPQRAAELAENLPPWIPRWSRA
SWSVQHDASPDGGLLVVNGGSIGFGRAISRFLPSYAAVGDGGFGELVRAEIAQDDRTSAPLTDLSAVLGI
NANVHSPLLGSYLRYPCATPEEWGQDPGVSLEECWVECDEGTGRLLLRRGKDGPPLRLVMLNFLLNELAP
RFYQFLNFFGAGSLANLAWWDRVDQRRGDPHTVRRYPRVRSGSLVLARRTWKVPADRLPDVATGNGADAF
AEVRRWQESLGLPDRVFYRGFTLPDPLVPTSEEEQHTWARTLARFPTSAERKPTFLDFTSVTSVRAWQRA
LRRCQGDLTFQECLPTVGDDGAQGHRERLTEEFIIETTEGAR