Home 

Gene Symbol:  
sioM
Organism:  
Streptomyces sioyaensis ATCC 13989
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
24303..25967 [1], 1665 bp
Product Function:  
NADH oxidase
Product Locus:  
 ACN80650.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosF in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:1665 bp
>sioM|ThioFinder177 Streptomyces sioyaensis ATCC 13989
ATGACCGCGGCCGATACCGGCGCACCGCCGCTCTCCGGTGACCCGTCGGAGCGCGGACCGTTCGACGACG
CGGGCGTGGACGCCTTCGTCCGCAGGCTCCGCGGCAGTTACGAGGAGGTCCACCCGCAGCACTGGCAGAT
CGACTGGCGGAACATCCCCAGCCCCTTCCGCTGGTACGCCGACCTGCCCCGCAGGGACCTGCCGACGATG
TCGCGGACGGTCGCGGCCGGTGGCCCCGCCGCGGCGGCCGCGTTCGCCGCGTCCGACCCGGCCACCCGGC
TCGGCGCGCTGCTCCAGGCCGGCTACGGCCTGACCGGTGTGCGGTGGTACCCCGCCGGCATCGCCAAGAG
CAGCCCCGAGGAGCCCACGCCGGTCCACCGCAACCCGCACTACCAGCTCCGCCGCGCCATGCCCTCGGGC
GGCGTGACGTACCCCGCCGAGTGCTACGTGGTCACCGCGGGCACGGCGGGCCTGGACGCGGGGATCCACC
ACTACGACGCGGTGCGCCACGCCCTGGCGGTGCTGTCCCGCGGCCGGCCGCCGGCGGAGCTGACGCCCCC
GGCGGGCGGTGTGCGGATCGTCCTCACCCAGCCGCTGTGGAAGAACTACTTCAAGTACGGCGACTTCTCC
TACCGGCTCGGCGCGATGGACACCGGGGCGGTGGTCGGCCAGTTCGCGCTCGCCGCCCGCTCGTGGAACC
TGCCCGCTCGCGTGGCGTTCGGCGTGGACGAGCGGCGGATCGCCGACCTCCTCGGGCTCGACCCCGAGGA
AGAGGCCACCCCGGCCGTGGTGGACATCGCACTGGGGGACCCGGCCGAGGCGGAGCGGGGGCCGGCCGCC
GGCCGCGCGGCTCCGGTCGGACGGCCCCGCTGGCTGGGGGCGTCCGCGCCGCCCGGCCCCACCACCGGTA
CCCGCCGCATGCACGCCGCCTGCCTGGCGGCCGGACGCCCCGGCCGGACGGTCGACCTCCCGCCCGTCGT
GCTGGAGGACCTGGCCGACCGGGCGGACGCGGAGCTGCCCGCGGTGTCCGGACGGCCGGTGTCGGTCGCC
GACTCCTGGGCCCGGTCGGCCCTCGGTGAGCAGCTCCGGGGCGCACCGCTCCCCGCGGACGTCCTGGCGG
ACTGGCTGCCCCAGGTGCTCGCCCCGCTGGACTGCGACGTGACCGGGAGCGGGGACGTCCCCGCCCTGAC
GCACCCGCGGTGCGTGCTGGTCGTCCGCTCCGTGCCGGGGGTGCCCCCGGGGGCCTACCTGCCGCAGCAG
GACGGGCGCCGGCTCGCCCGGCTTGCCGACGGGGACTTCGGGCCGGTGGTCCAGCGGAGCATGTTCGCGC
ACTACATGAACGTCGGACAGGCACCGCTGATCGCCGTCATGGTCGGTGCCACCGAGCCGCACCGCGGTGC
CAGCGGTCCGGTCGGCTATCGCACCCAGCATCTGCTGGCCGGCGTCCTCGCCCAGCGCCTGGCCGTGTGC
GCGGCGCGGGACGGCAGGTCCGCACACCCGGTGCTGGGCTTCGTCAGCGGCGTGCTCGACGAGGCCCTCG
GACTGGGGGCCCGACGCCTGACGTCCTTGCTGATGGTCCCCGTGGGCGGCTACCGCCGGGGCCTGTATCT
GGAGAACAGTCTGAGTCCGCTCGCCGCGGCGGCGGGCGACGGGGGTGGGATATGA
 Primer design

Protein Sequence:554 a.a.
>SioM|ThioFinder177 Streptomyces sioyaensis ATCC 13989
MTAADTGAPPLSGDPSERGPFDDAGVDAFVRRLRGSYEEVHPQHWQIDWRNIPSPFRWYADLPRRDLPTM
SRTVAAGGPAAAAAFAASDPATRLGALLQAGYGLTGVRWYPAGIAKSSPEEPTPVHRNPHYQLRRAMPSG
GVTYPAECYVVTAGTAGLDAGIHHYDAVRHALAVLSRGRPPAELTPPAGGVRIVLTQPLWKNYFKYGDFS
YRLGAMDTGAVVGQFALAARSWNLPARVAFGVDERRIADLLGLDPEEEATPAVVDIALGDPAEAERGPAA
GRAAPVGRPRWLGASAPPGPTTGTRRMHAACLAAGRPGRTVDLPPVVLEDLADRADAELPAVSGRPVSVA
DSWARSALGEQLRGAPLPADVLADWLPQVLAPLDCDVTGSGDVPALTHPRCVLVVRSVPGVPPGAYLPQQ
DGRRLARLADGDFGPVVQRSMFAHYMNVGQAPLIAVMVGATEPHRGASGPVGYRTQHLLAGVLAQRLAVC
AARDGRSAHPVLGFVSGVLDEALGLGARRLTSLLMVPVGGYRRGLYLENSLSPLAAAAGDGGGI