Home 

Gene Symbol:  
sioO
Organism:  
Streptomyces sioyaensis ATCC 13989
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
27673..29616 [1], 1944 bp
Product Function:  
cyclodehydrotase
Product Locus:  
 ACN80652.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosG in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:1944 bp
>sioO|ThioFinder179 Streptomyces sioyaensis ATCC 13989
ATGAGCGAAACGCTGACGTCGCGCCGCCGGGCGCCCCGGCTCCCCGACGACCCCGCGGCGGAGTTGCGCC
GATGGGTCGGCGACGCGGTCGATGTCCGCACCGCGGACGGCATGCCCGCGGCCGGGGACGGCCGCCCCGT
CGTCGTGGTGCACCTGGACTGGGATGCCGACCTCTCGGACCTCCCGGCGGCGGACACGGTCGTCGTGCCC
GTGTACGGGCTCCGCGGCCGGGTCGTCGTCGGCCCGGTGATGCGGCCCGGTCAACCCGGCTGCCCGCACT
GCCTGGCGCTGCGCGTACGGGCGGCGGATGGTCCGGAGGGCGTTCCCGCGGGGGCGGAGGCGGCCCCGCG
CCGGCTGTCCGCACGGCGCGCCGGCTGGCTGCCGCCCGGAGCCCTGCGCCTGGTGGCAGCCGTGGTGCGC
GACGAGGCGGAGCGGCTGGCCGCCGGCGTGCCCCCGCGCGGCGTCGACGCCGCCTTCGCGGTCGGGCCCG
CGCGGTTGACCGGCGACTGGCACCCGGCGCTCCCGCACACCTTGTGCACCGCACCGCACTGCCTCGGCAG
CCGCCGCCCGCTGCCGCCACCGGTTCCCGACCTGTCCAGGCCCCTGCCCACGACCGGCGTGGGCTCGGCA
CGACGCGTCCCGGCTGCCCGGTACGCCGACCGGCTGGAGCAGGAGTACCTCGACGCGTGGTCGGGCCTCA
CCCGGTCCGCCGCGGTCGGCGACCGGGCCGCCCTGCCCTCGACGCAGGTGCGGGTGCCCACCGTCTGGGG
ATTCGACGAGATCGCGATCGGGCGGGCCGAGGACTACGCGGGGGCCCGGCCCGCCGCGATCCTGGAAGGC
CTGGAGCGGTACGCCGGGTGGCACTGCGGCGGCCGCGACCCCGTCCGCTTCGCCGCGTTCGCCGAACTCG
ACGACGCGGTCGACCCCCGCTCCCTGCTCCTGCACCCCGACGAGGCGTACCGGCAGCCCGGATTCGAGTA
CACGCCGTTCACGCCGGACACCCGGACGGGGTGGGCCCAGGCGTACTCGGCGCACACCGGGCGGCCGGCG
CTGGTGCCGTTCCACGTCGCGTACTACGGCGCGACCAGGCGCCCGGACACCGGCCCGCGGTTCGTCTACG
AGAACTCCAACGGGTGCGCACTGGGATCCGGCGTCGAAGAGGCCCTGCTGGCCGCCTTGTTGGAGGTGGC
CGAGCGCGACGCCTTTCTGTGCGCGTGGTACTCCGGGACGCCGTTGCCGGAGATCGACCTCGGCGGGCTG
ACGGGCGAAGCCGCCCGCGCCGTGCGGACGGTGCGGCACCGGACCGGACGCGACCTGCGGGCCTTCCGGG
CCCTCGGCGCGTTCGACGTTCCCGTGGCCCTGCTCGTGACGACCTCACCCGATCCGGAGCGGCCGGCGAC
CCTGGTCACCGCGGGCTCGGGGCTCACGGTGGAGCGGGCGCTGCTCGGGGCGGTCCACGAGATGGCCGCC
GCCGCGCCCGTGATCACGGTGGAGTACCAGCGCCGCCGCCCCGAGTTGGAGCGCGCTCTGGACGCCCCCG
ACCTCGTGCGCCGCATGGAGGACCACGCCCTGGTCGGAGCCCTGCCCGGGGCCCGGCCGCGGTTCTCCTT
CCTCCTCGACGGGACGCCGCCGGACCCGTCGCCCGCCGTGACCCCCGCGCCACCGGCCGGCGACGTCGCG
GCGGATCTCGCCGCGATGCTCGCGGCGGCGCGGCGCGACGGACAGGAGGTCTTCGTCGTGGACCACACCA
CCGGCGAACTGGATCGCCTGGGCCTGAGCTGCGTGAAGGCGATCGTGCCGGGCACCGTGCCGATGACCTT
CGGCCACCGGCACCGACGGCTGCCGCCGCCCGAGACCCTCCAGGCGTTCCGGGCCAGGAACGGCATCGGC
CCCGTTGAGTTCCCCATCGAGGAGGTACGGCATGAGCCGCACCCATTCCCCTGA
 Primer design

Protein Sequence:647 a.a.
>SioO|ThioFinder179 Streptomyces sioyaensis ATCC 13989
MSETLTSRRRAPRLPDDPAAELRRWVGDAVDVRTADGMPAAGDGRPVVVVHLDWDADLSDLPAADTVVVP
VYGLRGRVVVGPVMRPGQPGCPHCLALRVRAADGPEGVPAGAEAAPRRLSARRAGWLPPGALRLVAAVVR
DEAERLAAGVPPRGVDAAFAVGPARLTGDWHPALPHTLCTAPHCLGSRRPLPPPVPDLSRPLPTTGVGSA
RRVPAARYADRLEQEYLDAWSGLTRSAAVGDRAALPSTQVRVPTVWGFDEIAIGRAEDYAGARPAAILEG
LERYAGWHCGGRDPVRFAAFAELDDAVDPRSLLLHPDEAYRQPGFEYTPFTPDTRTGWAQAYSAHTGRPA
LVPFHVAYYGATRRPDTGPRFVYENSNGCALGSGVEEALLAALLEVAERDAFLCAWYSGTPLPEIDLGGL
TGEAARAVRTVRHRTGRDLRAFRALGAFDVPVALLVTTSPDPERPATLVTAGSGLTVERALLGAVHEMAA
AAPVITVEYQRRRPELERALDAPDLVRRMEDHALVGALPGARPRFSFLLDGTPPDPSPAVTPAPPAGDVA
ADLAAMLAAARRDGQEVFVVDHTTGELDRLGLSCVKAIVPGTVPMTFGHRHRRLPPPETLQAFRARNGIG
PVEFPIEEVRHEPHPFP