Home 

Gene Symbol:  
sioN
Organism:  
Streptomyces sioyaensis ATCC 13989
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
25964..27676 [1], 1713 bp
Product Function:  
hypothetical protein
Product Locus:  
 ACN80651.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosH in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:1713 bp
>sioN|ThioFinder178 Streptomyces sioyaensis ATCC 13989
ATGACCGGCACTGTGCTGCGCCTGCGCGCCGATGCCTACTACGTACCGGTGCCCAACGGGGTGTGGATCC
GTACGACGGACGGCTCGTTCACCCTGAACGGCAAGACGGTCGCGACCTGGGTGGAGAAACTCGCCCCCCT
CCTGGACCGCGGCGTGGTGCCCGACGAGCTCCTCGGCGCGCTCAAGCCAGAGCAGGCCGCCTTCGTGGAC
AAGCTGCTGAAGGCGTTGGAGCAGCGGAAGGTGCTGCGGCCCGAACCCGCCGACGAGGGGGCCGACGACC
CGGAGTCGGCCCGTCTCTTCCCCCAACAGGCCGAGTACCTGCGCCACTTCACCGCCCGTCCCGCGGAGGG
CTTCGCCCGTGTCCGGCGGCACCCGCTGGCCGTGGCGGGCCCCGCCGAGCGGGTGGGGCCGTTGGCGACG
ACGCTGATGGAGACCGGCTTCGGCGACCTCGTGCTGCTGGACACGGCACCCGGGAAGGAACTCCAGGAAC
TCGCGGAGGACTTCGGCCGGCAGGGGGCGCCGGTACGCCTGTCCGGCCCGGACGGGGACCTCGAAGGACG
GACCGTGATCGGGGTCTTCGCCCCGGGAGAAGAAGAGGACGCCTGGCGGCTGCTGGACCGGGCCGAAGCG
CTCGGCAGCGGCGCCTGGGCGGCGCTGGTCCGCGGTCAGGCGATGCTCCTGAAGGGGCAGGTGCCCCGGT
CGGGCCGGGCCTGCGTCCGCTGCGCCTGGCGGCGCCTGGCCCACCAGGCCGTCGAACTGCCGCCGTCCGA
CGGGCTCGGGTACGTACCGGTGTCGGTGGCGGCGACCGTGCTGGCACAGGAGGTGTTCCAGTACGTCGCC
GGCGGCGACGACGCCGTGCTGGGCGAGGGCGTGGTGGTGGACCTGACCCGGCTCAGCATCTGGCGCACGG
ACGTCGATCCGGACCCCGACTGCCCCGGGCATGCGCTGCCCGCCGGCCCGGCGGACCCGTCGCTCGCTCC
GGCGGCCGGTCGGCGGACCCGGTTCCCCGACTCGGTCTTCGGCGCGCGGTGCTTCGGCCCGCTGTTCTCC
TGCACCCCCGAACAGCTCCCGCAGTTCCCCCTCACGGCGCTGCGCCTGCGGATCAACCCGCCGGGGCGCG
GCGAGCCGACGGGCTCGGCCGACGGCCCGGTCATCGTGGCGGAATCCGTGGCCGACGCCCGCGCCGAGGC
CGCCGTGACCGCGGTCGAGGCGACGCTTCCCACCAGCGGCGACACCGTCGTGGGCGTGGGCAAGGACCGC
GCCGAGGCAGGTGCCCGCGCCCTGCTCCGCTGGGCCGACGCGGCACTGGACGACGCGGCACCGGACGACG
CGGGTGCGGAACGCCGGGAGGGGACGGCCCGCTCCGAGCGGGCCCGCGCGCTCGCCGAACTGGCCGGCAG
GGACGTCGAGCTCAGCACGGCGCGCCATCCGAGCGGACTGTGGCGGGCCCGGGTGGACGGCACCGTCACC
CGGACCGGCTTCGACCCCGACCAGGCGGTGGAGCGCGCACTGCTGGCCGCCCTGGCACGGGGCCAACTCG
GGCACGGGGACGACGCGACGGCCGTGACGGCGTGGACGGGCACGGTCCCGGAGGAGCGCCGGGTCGACGA
GGTCGCGTCCGCACTCGGCCTGGCCTGGCGCGAGGCCGCCCTCCCGCCGCTGGTCGCCGCCGACCTGACC
GGCATCGTCCTGGCTCCGGGACACGCGGGATGA
 Primer design

Protein Sequence:570 a.a.
>SioN|ThioFinder178 Streptomyces sioyaensis ATCC 13989
MTGTVLRLRADAYYVPVPNGVWIRTTDGSFTLNGKTVATWVEKLAPLLDRGVVPDELLGALKPEQAAFVD
KLLKALEQRKVLRPEPADEGADDPESARLFPQQAEYLRHFTARPAEGFARVRRHPLAVAGPAERVGPLAT
TLMETGFGDLVLLDTAPGKELQELAEDFGRQGAPVRLSGPDGDLEGRTVIGVFAPGEEEDAWRLLDRAEA
LGSGAWAALVRGQAMLLKGQVPRSGRACVRCAWRRLAHQAVELPPSDGLGYVPVSVAATVLAQEVFQYVA
GGDDAVLGEGVVVDLTRLSIWRTDVDPDPDCPGHALPAGPADPSLAPAAGRRTRFPDSVFGARCFGPLFS
CTPEQLPQFPLTALRLRINPPGRGEPTGSADGPVIVAESVADARAEAAVTAVEATLPTSGDTVVGVGKDR
AEAGARALLRWADAALDDAAPDDAGAERREGTARSERARALAELAGRDVELSTARHPSGLWRARVDGTVT
RTGFDPDQAVERALLAALARGQLGHGDDATAVTAWTGTVPEERRVDEVASALGLAWREAALPPLVAADLT
GIVLAPGHAG