Home 

Gene Symbol:  
sioL
Organism:  
Streptomyces sioyaensis ATCC 13989
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
23194..24306 [1], 1113 bp
Product Function:  
hypothetical protein
Product Locus:  
 ACN80649.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosO in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:1113 bp
>sioL|ThioFinder176 Streptomyces sioyaensis ATCC 13989
ATGAGTGCCATGTCCAGCAGTGAACAAAAGGATCTCACCGTCAGCGTCCCGTGGTCGGTGCAGGAAGACC
TCCTTCTCGACGTGGCCGCGCCCACGCTGGAGGAGTCGGTGGCACTCGGCGAGACGGAGTCGTGGTTCTA
CCTGCGGGAGAACTACGGCGGCCGGCCGTTCCTGCGGCTGCGTTTCGCGACCCGGAGCCCGTCGGTCGAA
CGCCGCCTGAAGTCCCGGATCATGGAGCACATCGGGTCCGCGGCGTCCGACGACCCCTTCGAGCACCAGC
CGTACAACCACGAGCACGACTGGCTGGGCGGCGAAGCCGGACTGGGGCTGGCGGAGGCGTTCTGGACCGA
GACCACGCCGCTGGCGCTGCGGACCCTCCGTGCCACGCGCGGCGATCGAGCGCTCCGCCTCGCCGCGGCC
TTCGACTTCCTCGTGTGCAGCGGCGTGCTGCTCGCCCCCCATCTGCCGCCGCCCGTCGCCAAGTTCGGCT
TCAAGGCCGGCTACCTCTCCTACCTGGCGACGTTCGAGGGCTACATGCTGCTGATCCGGGACCCGGAGGG
CACCCGGGCCAAGCACGCCCAGCGGTACGAGCAGAACCGCAACCTGTTGCGGCCGCGCCTGCGCGCACTG
GTCGAGCAGATGCAGGACCCGGAGGGTGACCTGGCCGACGTCCCCGAACTGGCCCGTGAGTGGGCGGTGC
GGCTGCGCGGCTATCTCCCGGCCATCCGGAAGGGCTTCGACGAAGGCCGCTTCTACCTCTACGCCACCCC
GCGGAAGGCCGAAACGGCCAAGCTCACCCCGTCGCCCGACGGCCTCTACCGCAGGCCGAAGGTGGAGTGG
CTCGCCGACCTGCCGGAGGCCCCGGTGGCCGGCATCCACCGGGCCATCGCCGACAACACGTACTACCAGG
GCATGATCCGCGAGGACCGCCGGTTCCTGGCCTCCCGGCTGGCCCAGGCGTACACCAACTGGCACCTCTA
CCGGCTGGGCTTCCTGCTGGCCGACCGGTACACGCTCTTCTACCTGATCGCCCGCGCCTTCGAGGAGGAG
TACGACCTCGACGCGGCGGAGCTCATCCGGTCCGTGCAGCCGGAAGCCGAGGTCTCCGGATGA
 Primer design

Protein Sequence:370 a.a.
>SioL|ThioFinder176 Streptomyces sioyaensis ATCC 13989
MSAMSSSEQKDLTVSVPWSVQEDLLLDVAAPTLEESVALGETESWFYLRENYGGRPFLRLRFATRSPSVE
RRLKSRIMEHIGSAASDDPFEHQPYNHEHDWLGGEAGLGLAEAFWTETTPLALRTLRATRGDRALRLAAA
FDFLVCSGVLLAPHLPPPVAKFGFKAGYLSYLATFEGYMLLIRDPEGTRAKHAQRYEQNRNLLRPRLRAL
VEQMQDPEGDLADVPELAREWAVRLRGYLPAIRKGFDEGRFYLYATPRKAETAKLTPSPDGLYRRPKVEW
LADLPEAPVAGIHRAIADNTYYQGMIREDRRFLASRLAQAYTNWHLYRLGFLLADRYTLFYLIARAFEEE
YDLDAAELIRSVQPEAEVSG