Home 

Gene Symbol:  
cltF
Organism:  
Streptomyces hygroscopicus 10-22
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
9932..10957 [-1], 1026 bp
Product Function:  
putative lantibiotic biosynthesis protein
Product Locus:  
 ACS50128.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosD in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:1026 bp
>cltF|ThioFinder207 Streptomyces hygroscopicus 10-22
ATGCCGGAGAACGACAGCGGCCCGCTTGACCCCGAGGCCGCCCGGGGCGCGGACTGGGTGTGCGCGCACA
TCTTCTACGACACCGACCAGGATCTGCTGCTGACCGACTGTGTCAGGCCCCTGGTCGCGGAGCTGACCGC
CGACGGGCTGGTGCAGCGGTACTTCTTCCTGCGGTACTGGGAGGGCGGGCCCCATGTGCGGCTGCGGCTG
CTGCCCGCGGCGAGCGCCGACCGCTCGGCGATCGAGCTGCGGACCGGGAAACGCATCCGGGAGTTCCTGG
CCAGCACCCCGGCCGCGGACGTGGTGGACCGGTCCCGCTTCACCCAGGTCGCCGCCGGACTGGCCGGTCT
GGAGGGCCGCAGCGGCCACGACGTCCTGGTCCGCCCCAACAACTCCGTGGAGTTCCTGCCCTATGAACGC
GAGTACGACGACTACGGGCGGGGTGCGGCGATCGCCGCCGTGGAGCAGCACTTCTTCGAGTCGAGCCGGC
TCGCGCTGTCCGTGGTCGCGGCCGGGGCGACGGTGGAGCAGCGTGCGCTGCTGGCCTTCGACCTGGTCGT
CGGTGTGTTCGCGTTGTGCGAGGAGGTCCGCGACCAGTGGGCGCGGCACGGCGGACCGCCACTTCCGTTC
GGCAGCGGTCCCGAGGCCGAGGACGTCGCCCCGCGCTATCTGGCACAGCGCGACAAGCTGCGTGCGCGGG
CCCGCCTGACCTGGCGGATGGCGGAGGACCCCGGGGCGGGCGGGCACGATCAGCGGGCGTACTGGCTGGC
TTCGGTGCGGCGGCTGCGCGAGCGGTTGCACGCCCTGGAGGAGACGGGCGTGTTCACCTCCGCGTGGGCG
GGGTCTCCGCTGGCGGAGCCCCTCGGACTGTCCGACACCCGTCATCCGGGCACGAGTCTGGTGCTGCTGC
GCTGTGCCCACCTGGTCAGCAACCGGCTGGGGCTGACCCTGTGGCAGGAGAACCAACTGCGGTTCCTGGT
CGGCCGGGTGCTCGCTGAGCTGCCCGAGGCACTGGCCGCCTCGTGA
 Primer design

Protein Sequence:341 a.a.
>CltF|ThioFinder207 Streptomyces hygroscopicus 10-22
MPENDSGPLDPEAARGADWVCAHIFYDTDQDLLLTDCVRPLVAELTADGLVQRYFFLRYWEGGPHVRLRL
LPAASADRSAIELRTGKRIREFLASTPAADVVDRSRFTQVAAGLAGLEGRSGHDVLVRPNNSVEFLPYER
EYDDYGRGAAIAAVEQHFFESSRLALSVVAAGATVEQRALLAFDLVVGVFALCEEVRDQWARHGGPPLPF
GSGPEAEDVAPRYLAQRDKLRARARLTWRMAEDPGAGGHDQRAYWLASVRRLRERLHALEETGVFTSAWA
GSPLAEPLGLSDTRHPGTSLVLLRCAHLVSNRLGLTLWQENQLRFLVGRVLAELPEALAAS