Home 

Gene Symbol:  
cltD
Organism:  
Streptomyces hygroscopicus 10-22
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
17792..19735 [-1], 1944 bp
Product Function:  
putative peptidase containing docking domain
Product Locus:  
 ACS50133.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosH in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:1944 bp
>cltD|ThioFinder212 Streptomyces hygroscopicus 10-22
ATGGCCGTGACAATCGCCAGACCACCGAATCGGAGGCTGGCGATGCGTCCCAAACTCAAGTCCGACGTGC
TGTACGTGCCGACCGACAACGGAGTACATGTGTTCGGGGCGGGAGCCGATGTGGCCCTGCGCGGCCGGGC
CGCCTATCAATGGCTCGACCGGCTCGCCCCGCACTTCGACGGCCGGACCGAGTTGGAGGACCTGGTGCGG
GGCCTGCCGGAGGAGAAACGGCAGATCGTGGACGCCCTGGTGGAGCGGCTGCGCGCGGCCGGATGCGTCC
TGGACGCCGCCGACGACCTCCCGCACGGCCTGACCGACCGGGAGCTGGAGACCTACGCGGCCGAGATCGC
GTTCGTCGAGTACCACCTCGACTCCGCTCCGAGGCGGTTCGAGACCTACCGCGACAGCGAGGTCGTCGTA
ATGGGTGCGGGCCCAGTGTTCGTCTCGCTGGTCTGCTCGGCGCTGCACTCCGGGGTGCGGCGGCTGCGGG
CGGTGCGGACGACGGAAGCGGCGACGGACTCGGGGCGGCTGACGGAACTGGCCGCCGAGGCGCTGCACCG
CGACCCGGACCAGGAAGTGGAGCATGCCGTCTGGTCCCCGGAGGAGGAGGCAGCGGCGGCCCGTGCCGAT
GTCGTCCTGCACGTCGTCTCCGCCGGTGATCGCGTCGATCGTGCGGTGCGGCTGGACCGGCTCTGCCGGG
ACTCCGGCGCCCTCCTGGTGCAGGGCCTGGTCCTCGCCGACGTCGCCTGGCTGGGCCCGTGCGGCCCCGG
TTGGGCGTCGGCCTGGTCCCGGCTGGGGGCGGCGGGGCCGTACCGGTCCAGCCGCTTCCTCGGCGGGCCG
GCCGCCGCCGTCGTCGCCGGTCATCTCGGACTCGCCGCGTTCAAGGCCCGCACCGGGATCAGCGGTTCCC
ACGAGACGGAGCTGACCCGTATCGACCTGGAGACGCTGCGCACCTCGGCTCACGCGTTCCTGCCCCACCC
GGACGCCCTGGCCGTGCGCCCGGAGCGGGAAGAGGAGTTCGTCAGCCGGGTCCGCGCGCTCCGGGCGGCC
GGACCGGTCGGCGAGCAGGAGTTCTCCGCGCGTGCGGCGCGCTGCTTCGATCCTCATCTCGGGGTGCTGC
GCAGCCTGGAGGAAGGTGAGTTCACGCAGGTGCCGCTGAACGTCACCGAAGCGGTCCGGCCCACGGACGA
CGGTGCTCCGCGTGTGTTCGGCGCCGGGACGAGTTTCGCCGAGGCCCGCCGCGCGGCCGCCTTGCGCGGA
ATCGCGGTGTACGCGGCACGGTTCACCGACCCGCGCCGCGTGGACGCGGACGCCACCGTGTGGGGTTGGG
ACGTCCCGGACGGGTGCGCGCGGCGCGTTCCCACGTCCGTGGCGTCGGGCCTCGGACCCGGGGTGGCGGC
GCGGCTCGGCTGGGACGACGCGGTGACCGACGGGCTGGCCCAGCACTGCGTCCGGCTGGCCGTTGCGGAC
GTGGCCGACGGGCGCGTCGAGCCCGCCGGCCTGGACCTCGCCACCGCCGTGTTCGACGCCCGCGCGAAGT
CGCTCCTCGGTCTGCTGCGGGCGGCCGGGGGATCGGTGCGGGTGGCCGACGTGGGGGGCGCGCTCGGGGT
GCCGGTGCTGGCCTGGTGGCAGGGCGGCCGTGCGGTGGCGGCGACCTGCGGTCCGGACGCGGTCGCGGAC
GGTCTGGAGCGAGCCCTGCTGGACCGGCAGGCCGTCATCACCGGCGAGCCTGCGTACGCGCCGCCGACCG
TGGCGGGGTTGGGGTCACCGCCCGGGGAGGGACCGGCGGCCGGTGCTCCGTGGCCGTCCGCACCCGGGCC
GGAGCGCATGGTGGACTGCCTGCGGGCCCGCGGCCTGCGACCGGTGGCCCTGCCGCTGGACCACGACCCC
GCCGTGCACGAAGTGCTGCCCTCCCTGCTCCGGGTCGTGGTCCTCGATGACTAG
 Primer design

Protein Sequence:647 a.a.
>CltD|ThioFinder212 Streptomyces hygroscopicus 10-22
MAVTIARPPNRRLAMRPKLKSDVLYVPTDNGVHVFGAGADVALRGRAAYQWLDRLAPHFDGRTELEDLVR
GLPEEKRQIVDALVERLRAAGCVLDAADDLPHGLTDRELETYAAEIAFVEYHLDSAPRRFETYRDSEVVV
MGAGPVFVSLVCSALHSGVRRLRAVRTTEAATDSGRLTELAAEALHRDPDQEVEHAVWSPEEEAAAARAD
VVLHVVSAGDRVDRAVRLDRLCRDSGALLVQGLVLADVAWLGPCGPGWASAWSRLGAAGPYRSSRFLGGP
AAAVVAGHLGLAAFKARTGISGSHETELTRIDLETLRTSAHAFLPHPDALAVRPEREEEFVSRVRALRAA
GPVGEQEFSARAARCFDPHLGVLRSLEEGEFTQVPLNVTEAVRPTDDGAPRVFGAGTSFAEARRAAALRG
IAVYAARFTDPRRVDADATVWGWDVPDGCARRVPTSVASGLGPGVAARLGWDDAVTDGLAQHCVRLAVAD
VADGRVEPAGLDLATAVFDARAKSLLGLLRAAGGSVRVADVGGALGVPVLAWWQGGRAVAATCGPDAVAD
GLERALLDRQAVITGEPAYAPPTVAGLGSPPGEGPAAGAPWPSAPGPERMVDCLRARGLRPVALPLDHDP
AVHEVLPSLLRVVVLDD