Home 

Gene Symbol:  
cltG
Organism:  
Streptomyces hygroscopicus 10-22
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
8700..9827 [-1], 1128 bp
Product Function:  
unknown
Product Locus:  
 ACS50127.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosO in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:1128 bp
>cltG|ThioFinder206 Streptomyces hygroscopicus 10-22
TCAGCCGGCTCCGCCGGCGGCCCACGCCTCGCCGATACGGCGCCACTCGGGCCGTTCCGAGGAGGGGTCG
ACGGAGGCGACGTACCGCTGGAAGCTGCCGACCGCGTCAACGCCGTGCACCGCCTCGACGGTGAGCGCCG
CCAGATGGCACAGCAGCGCCCGGTCGACCGGCTTGAGTCCGAGCCGGTTGAGGTGCAGGTAGAGGTAGTT
CATCATGAGGCGGAACGAGGCGAACCAGTCGTCCGTCCGTACGAAGTCCTCGTGCCCGTGGTCCGACCGC
AGGACCGCGTGGAACTCGCTCGTCCGACGCGTCGGCATCCGAGGTGCCCGGGCGGCCCCGCCCATCGACA
CCTCGCCGGAGGCCAGCAGCGGGTGCGCGATCCGCTGGTGGTGGCGCACCGCGGCCGCCCATTCCGTGAC
GAACGGCACCACGTCACCGACTGCCTCCGAGCGGTCCGACCGGTCCGAGCGATCCGCTCCGTCCCCTTCA
GTCGCTCCGTCCGAGAGGGCCGCTTCCACGGACCGCAGCCGCTCGCACAGCACCGTCTCCTGCCGCCGGA
ACCGGTCGTCGAAAGCGGCCCGCACGGCCACCGGGTCCCGGGTGCGGGACAGGAACGCGTCGGCATGCGA
TCGCAACGACAGGAAGCCACGCTCGATCGGCTCCCCGCCCGTGGTGAAGGGGACAGCCGCGACGGACGTC
GTCGTCCACATCAGGTCCAAAGCGAGCAGCGACAGCGCGCCGCCCGCCCGCACCCGCTCGTACGCCCGGA
AAGCCTGGCCGTTGGTGTCGCTGAGGAAGCCGGCCAACAGCTCGCTCGCCCGCAGCGACTCCAGCACGGG
CAGCCGGTGATCGTACGGCCGTTCCAGCACCGTATTGTCGGGCACCCACGGGTGTCTCGGGCCGGTCTCC
ATCTCCAGCTCCGCAAGCCGGGCGTGCACCGGGGCGAGCGCGCCCTCGTCCAGCCGTGCCGCGGAGGGAC
GGGCGCGCAGGTAGTCCGTCACGATCCCGGTCACCGTCGGCCGGACGCGCTCCTCCCAGTCCGTGCCGCG
ACAGCGGAAGTTCAGCCGCAGATGCGGACCGCGCAACCAGTGCCGGCCGAACCAGGCCGCCTCGGCCCAC
GGTGCCAC
 Primer design

Protein Sequence:375 a.a.
>CltG|ThioFinder206 Streptomyces hygroscopicus 10-22
MAPWAEAAWFGRHWLRGPHLRLNFRCRGTDWEERVRPTVTGIVTDYLRARPSAARLDEGALAPVHARLAE
LEMETGPRHPWVPDNTVLERPYDHRLPVLESLRASELLAGFLSDTNGQAFRAYERVRAGGALSLLALDLM
WTTTSVAAVPFTTGGEPIERGFLSLRSHADAFLSRTRDPVAVRAAFDDRFRRQETVLCERLRSVEAALSD
GATEGDGADRSDRSDRSEAVGDVVPFVTEWAAAVRHHQRIAHPLLASGEVSMGGAARAPRMPTRRTSEFH
AVLRSDHGHEDFVRTDDWFASFRLMMNYLYLHLNRLGLKPVDRALLCHLAALTVEAVHGVDAVGSFQRYV
ASVDPSSERPEWRRIGEAWAAGGAG