Home 

Gene Symbol:  
tpdC
Organism:  
Nonomuraea sp. Bp3714-39
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
7475..8290 [1], 816 bp
Product Function:  
dehydratase
Product Locus:  
 ACS83783.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosD in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:816 bp
>tpdC|ThioFinder222 Nonomuraea sp. Bp3714-39
ATGAGCTGGGTGAGCGTGCACGTCTTCTCGCAGGGGCCGCTCGACGACATGATCACGGGCCTGGCCGGGC
CGCTCCTCGGCGACGACGGCTTCTTCCTGCGCTACTGGGAGGGCGGCCCGCATCTGCGGATCAGGGTCAG
GTCCCACCCGGCGGAGCAGGTCGTCGAGCGGGCCGAGGCGTATCTGCGCGAGCACCCGTCAGAGGCGGTG
ATCGACCCGGAGGAGTACGCCAGGCTCGCCGCGACCCTCGCCGCCCGCGAAGGCGTCCCCGGCTATACGC
GGCGCCTCTATCCGAACGACTCCGCCCACCTCATCCCGTACCAGCCGGAACACGACCGCTACGGCACGGG
CCGCTCGCTCGACGCCGTGGAGCGGCACTTCCACGACTCCAGCGTGATCGCACTCCAGCTGATCGGGGCG
GGGCTCGGACACGAGCGGCGGAGCATGGCGTGGCTGACCATGCTGCTGGTCGCCTGGCAGGTCGCGGGGG
AGGGCAGGGCGTTCGGCCCGCCCGCTGACGCCGGGGTTCAGGTGCCCCACGAGCGGATGGCGGCGCTGGT
CGAGCACGCCAGGGCGGTGACACAGGAGCCTGCGCCGAGCGAGCCCCGTGGCGTGGTGGCCGCCTGGTAC
GCCTCGATCGCGCGGCTGGTGGAGGAACTGGCGGCGGCGGGGTTCGACGCGGCGCGGACGGGGGCGACCG
TCGATCTGGCCGCGCATCTGCTGGCCAACAGGCTGGGGATCCGGGTGCAGGAGGAGGCCCGGCTGCGTCA
CCTGGCGTCCGGGGCCACGAGGGAGTCGGAGGTGGGGGTCGGATGA
 Primer design

Protein Sequence:271 a.a.
>TpdC|ThioFinder222 Nonomuraea sp. Bp3714-39
MSWVSVHVFSQGPLDDMITGLAGPLLGDDGFFLRYWEGGPHLRIRVRSHPAEQVVERAEAYLREHPSEAV
IDPEEYARLAATLAAREGVPGYTRRLYPNDSAHLIPYQPEHDRYGTGRSLDAVERHFHDSSVIALQLIGA
GLGHERRSMAWLTMLLVAWQVAGEGRAFGPPADAGVQVPHERMAALVEHARAVTQEPAPSEPRGVVAAWY
ASIARLVEELAAAGFDAARTGATVDLAAHLLANRLGIRVQEEARLRHLASGATRESEVGVG