Home 

Gene Symbol:  
tpdB
Organism:  
Nonomuraea sp. Bp3714-39
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
4866..7478 [1], 2613 bp
Product Function:  
dehydratase
Product Locus:  
 ACS83782.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosE in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:2613 bp
>tpdB|ThioFinder221 Nonomuraea sp. Bp3714-39
TTGCCTTTTGGCGCCAATAAAGCGAATGGGGCTCATGTAATGGCGGTTATTGAGCGGGAAGAAAGCGACG
GCCCGCCGGTCGCTGTCCGCACGTGCGGGGTCGCGGCCGCGGAGCTGGAATCCCTGCGATGGGACGAGTC
CTATGCGCTGGTGACCCGGCTGCTCGCGGAGACCGCCCGGGTGGCGGCGGACGGGCGGCGGCTGGCCGTG
GCGCTCGGTGACGTCATCGGAGGGCTCGGCCCGTCCGGGTCCCGGCCCGTCCTCGTGGGGCTGCGGCGGG
CGCTGCACACCGGGCGTCTCCCCTCCGGGCGGGAGTGGGGGCCCGAGGCCGGGGCGGCGCTGCCGTACGG
GCTGAGGGGCGAGGTGGAGGAGTGGGTACGGCGTGCGCGCGAGTGCGCCGGGCTGCGCGCCCGCCTGCCC
GAGGTCGTCGCCCGGGAGTCCCTGGAGAAGGAGGAACGGCTGCGCGCCGCCGCGGCCGACCCCGCCTTCC
GCAGGGGGCTGGCGCTGGCCGGCGGCGAGCTGGCGGTCGACCTGGAGACGTGGCTCGCGGACCCCGCGCG
GCGCCCCAAGCCGCAGAAGCTGCTCAGGCTGGCCAAATACCTGGTCAGGGCCGCCGTGAAGACCAGCCCG
TACAGCACGTTCACGAGCACCGGGCGGGCGGTGTGGGGCGGTGGCGAGCGGCACGTGGAGCGCGTGGTGC
CGGTGCTGGAACTCGACGGCGTCCAGACGTTCTCGGACGATCGGGTCAGGGTGAATCCGTCGGTCACCGT
CGCGGGCGGGACGGCGGAGTTCATCGGGCCGCCTCCCGGGGAGGCGCTGGTGTCCATCGGGGTGACGGAG
GCGGTGGCCGCGTGCCTGCGCGTCGCGGAGGGCGGGGAGTGGGTGCCGCGGGGCCGGTTCGCGGAGGCTC
TGGGGGCTGAGCCTGCCGCAGTCACGAAATTTCTGGACAAGTTGCTTGCGGTTGGGCTCCTGGAGGCCCG
GCCGGACGGCGACCCGCCCCCGCACCTGCTGGACGGGATCCGGCGCACGGAACGCGCCACCGACCCGTCC
ACCTTCCGCCACGAACTCGGCCGCCTGATCGCCGCCGCCCGCGCCGCCGCCCGCGCCACCGCCCCCGGCG
CTGACACGGCCAAGAACGCCGCCCCTGCCGGGCGCGCCACCCGCGGCGATGGCGGTGCTGATGCCGAGCG
CGCCACCCGCGGCGATAGCGATGCTGATGACGGGCGCGCCACCCGGGGCGACGGCGGTGCTGATGACAGG
GGCGCCGCGCGGGGCGACGGCGGTGTGGGGCGGGCGGTTGTGCACGAGGTCGCGGTCTGCGTCGAGCCCG
TGGCGAGGCTGGATCCGGCGCGATGGCGTGGCGGGCTTGCCGATCTCGACGTCGTACGCCGCTGGCTGGC
CGTTTTCGACGCCAAGCACCCCATGCGCCTCGCGGTCGCCGCCTACCTCACCACCCGGTACGGCCCCGAC
CCGGCCGTCCCCTTCCTCACGCTCCACCGCCACATCCAGCGCGAGCTGGCCGGCACCGGCGCGGCAGGCC
GGGAGTTGCGCGCGTTCCTCGGCTCGTCGGCCGCCTGGACCCAGCCGCTAGGCACCTCCGCCCTGCCCAG
GATCAGGGAGCTGGAGCGCCTCAGAGCCGAGGCGAGAAGCCTGGCGCTGGACGCGGAGGACCCCGACGGC
ACCTGCCGCGTCACCCCCGGACAGCTGGCCGCGCAGCTGGAGTCGTGGCCGTCTTGGATCGCGATCCCCG
CCTCCTCGGCCTGCTACGTACAGGCGGTGGCCGGCACCCTGGTGCTCAACGTCGTCCACGGCGGGCACGG
CCGAGCCCTGCGCAGGCTCGACCACCTCCTCGAACGCGCCGGCGGCCACCCCGAGCCGCCCCGGATCGAG
GACCCGGACGGCGCGGTCTACGCCGAGTTCTCCGGCGACCTGGGCTCCACGCTCAACGCGCGCCCGCCGA
GCACCCGATACGAGATCGACTACCCCCACTCGCCCGGCACGCGCCCGCCCGACCTGCGGCTGCCGCTCAC
GGACCTGCACGTGACGCTCTGCCCGGACAGCGGCCTGCCCGAGCTGCGTTCCAAGCGGCTCGGCCGCCGG
GTCGTGCCGTTGCATCTCGGGCTGGCCGCCGAGTTCCGGCTTCCGCCGGCCGCGCGGTTCATCGAACGCG
TCTTCGGCCCCGGCTACCTGCTCCATCCCAGCTCGCCGCCGCTGGTGCGGATGGGCCGGGTCCCCTCGGA
GGTCACCCGGTATCCACGCGTCGAGGCCGGGCGCGTGGTGGTGCAGCGGCGTCGCTGGCTGGCGCCTGCG
GCCACGCTGCCGGTGCGCGCGAAGGGCGAGGGCGACGCGGCGTACCTCACGCGGCTGATCGCCTGGGCGG
ACGAGTACGGCGTACCGCACCGATCGTTCGTCCGCGCCTGGCCGGAGCAGACCGGCGACAAAGGGCAGGA
CAAGGCGCGCAAACCGCTCTTCCTGGACCTGGCGAACCTGTTCCTGGTCAAGAACTTCGAGCGGCAGATA
CGTGGCTGCGCGTTCGCGCTCTTCGAGGAGGCGCTGCCCGACCCGGGACCGGAGCGGGTGACCGAATACC
TGATCGAGGTGGGAGGCCGATGA
 Primer design

Protein Sequence:870 a.a.
>TpdB|ThioFinder221 Nonomuraea sp. Bp3714-39
MPFGANKANGAHVMAVIEREESDGPPVAVRTCGVAAAELESLRWDESYALVTRLLAETARVAADGRRLAV
ALGDVIGGLGPSGSRPVLVGLRRALHTGRLPSGREWGPEAGAALPYGLRGEVEEWVRRARECAGLRARLP
EVVARESLEKEERLRAAAADPAFRRGLALAGGELAVDLETWLADPARRPKPQKLLRLAKYLVRAAVKTSP
YSTFTSTGRAVWGGGERHVERVVPVLELDGVQTFSDDRVRVNPSVTVAGGTAEFIGPPPGEALVSIGVTE
AVAACLRVAEGGEWVPRGRFAEALGAEPAAVTKFLDKLLAVGLLEARPDGDPPPHLLDGIRRTERATDPS
TFRHELGRLIAAARAAARATAPGADTAKNAAPAGRATRGDGGADAERATRGDSDADDGRATRGDGGADDR
GAARGDGGVGRAVVHEVAVCVEPVARLDPARWRGGLADLDVVRRWLAVFDAKHPMRLAVAAYLTTRYGPD
PAVPFLTLHRHIQRELAGTGAAGRELRAFLGSSAAWTQPLGTSALPRIRELERLRAEARSLALDAEDPDG
TCRVTPGQLAAQLESWPSWIAIPASSACYVQAVAGTLVLNVVHGGHGRALRRLDHLLERAGGHPEPPRIE
DPDGAVYAEFSGDLGSTLNARPPSTRYEIDYPHSPGTRPPDLRLPLTDLHVTLCPDSGLPELRSKRLGRR
VVPLHLGLAAEFRLPPAARFIERVFGPGYLLHPSSPPLVRMGRVPSEVTRYPRVEAGRVVVQRRRWLAPA
ATLPVRAKGEGDAAYLTRLIAWADEYGVPHRSFVRAWPEQTGDKGQDKARKPLFLDLANLFLVKNFERQI
RGCAFALFEEALPDPGPERVTEYLIEVGGR