Home 

Gene Symbol:  
tpdE
Organism:  
Nonomuraea sp. Bp3714-39
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
9243..10529 [1], 1287 bp
Product Function:  
dehydrogenase
Product Locus:  
 ACS83785.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosF in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:1287 bp
>tpdE|ThioFinder224 Nonomuraea sp. Bp3714-39
ATGACCGGGGAACGGTACGAGCTGCGCGCCGGCGTGCACCTCGCCCGGCTGGACGCGGGGGTCCGCCTGT
TCGCCTGGCCGCACGCCGAGACCCTCGGCGAGCTCACGCGGGATGAGCTCGACCTGCTCCGCGACCTGGC
CGCCGGACCCCGCACCGCCGGGGGACCGCTCGTCGAACGCCTGCGCGCCGGAGGCTGGCTCAAGATCACG
ATTACCCGGGACGGCGTGCCCCTCTACACGCTCGCCCCGCTGCGCCCGCCGCCGCCACGGCCGGCGGTGC
CGGAGCGGCCGGTTCTGTCCAGGTTCGCCACGCTGCGGCGCGAGGGGGACGCGCTGGTCGCCGGCTCCCC
GCTGGCCTGGTGCGACCTGTACGTCCACGACCCCGGCCTGGTCGGCGACGTGGTCCGGCCCGGCGGCGAG
GTCCTGGCCGACCTGGTGTGGGCCGGGCTGGCCGTGCCCGAGGAGGCCGAGGACCGGGAGCTGCGGTTCC
GGCAGTGGGCGCCGCACGAGCTGGAGTTCCATGACCGGAGCCGGGTGGGGCACCGCGGCTACCTGGGCGA
TGGGTTCGGCGGGACGTTCTGGGCCCGCGGCCGGTTCGACCCGCTGCCCGCCCGGCCCCGGCCCTACCCC
GGCCGGGCGATCGAGCTGCCCACGCCCGACCTGGACGAACTGCGGCTCAAGGACCCCTCGCTCACGGACG
TGCTGGAGGGCCGCAGGTCCGTACGCGAGCACGACGACGAGCGCCCGATCACCCTCGACCTGCTCGGCGA
GCTGCTGTACCGCACGGCCAGGGTGCGGGAGTGCTGGACGGCCGACGGCGTCGAATACACCCGCAAGCCG
TACCCCTCCGGAGGGTCCGTCTACGAGCTGGAGATCTACCCCGTCGTCAGGAACGTGGCCGGGCTCGAAC
CCGGCATGTACCACTACGACGGGCACGACCACGTGCTCAGGCCGGTACGTGAGGCCGGCCATCCCGCCGT
ACGCCGGCTGCTGACCGTCGCCGGGCACGGCGCCGCCACCGGCCGCCGCCCCCAGGTCCTGCTCGCGGTC
TCCAGCCGCGCCGGCCGGCTGCTGTGGAAGTACGAAGGCATGGGGTACGCGCTGACGCTCAAGCACGTGG
GTGTGCTCTACCAGACGCTCTACTGCGTGGCCACGGCGATGGGCCTGGCGGCCTGCGGGCTCGGCAGCGG
CGACTCGGCCGCGTTCGCCGAGGCGACCGGGCGGGACCCGTTGGAGGAGTGCGCGGTCGGCGAATTCATG
ATCGGAACCGCGGAGGCACCACGTTGA
 Primer design

Protein Sequence:428 a.a.
>TpdE|ThioFinder224 Nonomuraea sp. Bp3714-39
MTGERYELRAGVHLARLDAGVRLFAWPHAETLGELTRDELDLLRDLAAGPRTAGGPLVERLRAGGWLKIT
ITRDGVPLYTLAPLRPPPPRPAVPERPVLSRFATLRREGDALVAGSPLAWCDLYVHDPGLVGDVVRPGGE
VLADLVWAGLAVPEEAEDRELRFRQWAPHELEFHDRSRVGHRGYLGDGFGGTFWARGRFDPLPARPRPYP
GRAIELPTPDLDELRLKDPSLTDVLEGRRSVREHDDERPITLDLLGELLYRTARVRECWTADGVEYTRKP
YPSGGSVYELEIYPVVRNVAGLEPGMYHYDGHDHVLRPVREAGHPAVRRLLTVAGHGAATGRRPQVLLAV
SSRAGRLLWKYEGMGYALTLKHVGVLYQTLYCVATAMGLAACGLGSGDSAAFAEATGRDPLEECAVGEFM
IGTAEAPR