Home 

Gene Symbol:  
tpdG
Organism:  
Nonomuraea sp. Bp3714-39
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
12411..14255 [1], 1845 bp
Product Function:  
cyclodehydratase
Product Locus:  
 ACS83787.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosG in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:1845 bp
>tpdG|ThioFinder226 Nonomuraea sp. Bp3714-39
ATGGCTGAGGTCGTGGGGACGGGCCTGCTGGCCGAGGAGATCACGATCGCGCTGAAGGACCGCGACGGGC
GGGCAGAGGTGACGATCACCGCCTGCGACGGCTGGGCGCGCGGCCCCCGGCGCGACGGGGCGGCGTGGTT
GCCCGTGCGGGTCGAGTACGGGGTCGCCGTCATCGGGCCGCTGGAACGCCCCGGCGAACCCGGCTGCGTG
ACCTGCTTCGAGACCCGCCGGGACCGGGTCAGGACCGACAGCGCCGATCGGGCCGCCGTCCTGGCCGTCC
ACGGCCCCGAACTCGCCGGGCGGGCCTCCCCGTACCTCGGCCGCCTGGCCGCCCGCACGATCGCGGCCCT
GGCCGCGCACGCCGCCGAGGGCCCCGGATGCGCCGTCTGGTACGTCGACCTGCGCACGCTCACCGCCGAA
CGCCACACGTTCCTGCCGGAACCCCACTGCCCCGACTGCGGCGACCTGCCGGACGACGACCGCGCGTCCG
CCGCCTTCGAGCCCGGCGCCGCCCCGCGACCTCCCGGCTACCGGGTCAGGAACGTGCCGGCCGAGCACGG
CGCGCTGCTCGACACGTACGTGGACGGCGAATGCGGGCTGATCAGGCCCCTCGTCCGGGACACGCTCGGC
GGCCTGGTGATCGCCGGGGCGATGCTGCCGCTGCGGTTCGAGGGCGGTTCGGAGCCCGGCGTGGGCCGCA
CCCGCGGCTACCGGGCCAGCGAGGTCACCGCCGTGCTCGAAGCGCTCGAACGGTGGGGCGGCGTCGAGCC
CGGCGGCAAGCGCACCCGCGTGCGGGCCTCGTACGCGGAGGTGGCCGCGGACGCGCTCGACCCTCGAACG
CTGGGCGAGCACGACACCTCCTCCTACGAGATGGAGGGGTTCGCGTTCCGGCCGTTCGCCGAGGACGCCG
TCTGCGACTGGGTGTGGGGGTACTCCTTCGCCCGGCGCTCGCCGATCCTCGTGCCGGAGAGCCTGGCCTA
TTACTACGTACGGGGGCGGGAGCGGCCGTTCCTCTTCGAGATCTCGAACGGGTGCGCGCTCGGCGGCAGC
ATGGCGGAGGCCCTGCTCTACGGGCTGCTGGAGACGGTCGAGCGGGACGCCTTTCTCATGACCTGGTACG
GGCGGCTCCCGGTGCCGCGGATCGACCCCGGCACGGCACGGGACCGCACCATCCCGCTCCAGGCCGCCGC
GATCATCGCGGAGACCGGTTATCGGGTGGAGCTGTACGACACGACGATGGAGCACGGCATCCCCAGCGTG
TGGGCGATGGGCGTGCGGCAGGACGGCGATCCGGGCAGGCCGCGCCTGGTGTGCGCCGCCGGGGCCCACC
TGGTGCCGGAGAAGGCCGTGCTCAGCGCGCTGAGCGAGCTGGGGCCGCTGCTGGCCGACCTGATCCGGCG
GTATCCGGACGAGGTGCACCGAGCCCAGGAGATGGTGACAAATCCTGATCTGGTGGCGACGATGCACGAC
CACTCCACCCTGTACGGCGCCGACGCGGCCTTCGACCGGCTCTCGTTCCTGACCGGCGGCACGGGCGTGC
GGGGGCTGCCCGACATGGAGGCGTTCACCGTGCCCGGTGATCTCGACGTCATGAGGGTGGTGGACCGCTT
CCTCGCCGAGGGGATGGACGTCGTCGTCATCGACCAGACCACGCCGGAGCATCGGGCCCGCGGTTTCTCC
TGCGTCAAGGTGCTGGTGCCCGGCACGCTCCCGATGACCTTCGGCCACCGCAACCGCAGGGTGCGGGGCC
TGACCCGCCCGCTGGAGCTGCCGTACCGGCTCGGCCACCGCGACACGCCCCTGACCCCCGCCGACCTGAA
CCCCGACCCACACCCCTTCCCATGA
 Primer design

Protein Sequence:614 a.a.
>TpdG|ThioFinder226 Nonomuraea sp. Bp3714-39
MAEVVGTGLLAEEITIALKDRDGRAEVTITACDGWARGPRRDGAAWLPVRVEYGVAVIGPLERPGEPGCV
TCFETRRDRVRTDSADRAAVLAVHGPELAGRASPYLGRLAARTIAALAAHAAEGPGCAVWYVDLRTLTAE
RHTFLPEPHCPDCGDLPDDDRASAAFEPGAAPRPPGYRVRNVPAEHGALLDTYVDGECGLIRPLVRDTLG
GLVIAGAMLPLRFEGGSEPGVGRTRGYRASEVTAVLEALERWGGVEPGGKRTRVRASYAEVAADALDPRT
LGEHDTSSYEMEGFAFRPFAEDAVCDWVWGYSFARRSPILVPESLAYYYVRGRERPFLFEISNGCALGGS
MAEALLYGLLETVERDAFLMTWYGRLPVPRIDPGTARDRTIPLQAAAIIAETGYRVELYDTTMEHGIPSV
WAMGVRQDGDPGRPRLVCAAGAHLVPEKAVLSALSELGPLLADLIRRYPDEVHRAQEMVTNPDLVATMHD
HSTLYGADAAFDRLSFLTGGTGVRGLPDMEAFTVPGDLDVMRVVDRFLAEGMDVVVIDQTTPEHRARGFS
CVKVLVPGTLPMTFGHRNRRVRGLTRPLELPYRLGHRDTPLTPADLNPDPHPFP