Home 

Gene Symbol:  
tpdF
Organism:  
Nonomuraea sp. Bp3714-39
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
10526..12418 [1], 1893 bp
Product Function:  
hypothetical protein
Product Locus:  
 ACS83786.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosH in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:1893 bp
>tpdF|ThioFinder225 Nonomuraea sp. Bp3714-39
TTGAACGACTTCAAACCCAGACTCCCCGCGGACATACGCTTCGCGCCCACCTCCGGCGGTGTCGCCTTCC
TCACCCGCGAAGGCGTCGTGCGGATGAACGGGGCCTCCGTCCACCTGTGGGTGGAGCGGCTGGCCGTGCA
CCTCGACGGGAGCAGGACCGTGGCCGAGCTGACCGCGGAGCTGCCCGACGAGCGGCGGGCGTTCGTGACG
AGCCTGCTGACCACGCTGCGCGAGCGCGGGCTCGTGGAGGACGCGGGAGAGCGCGGCGTGCTGCCCGTGG
CGGCCGGCACCGCGTGCTCGCTGCTGGCCGACGCGGACCGGTTCGGCGAGCTGGCGCCCGCCCTGGCCGA
CGCCCTGCGCAGGCTGGGGCTGGAGGTGCTGACAGAGCCGTCGGGCGGGGCGCTCGTGCACGTCGCGGCG
GCCGACGCGGACGGGCTGGCCGCCGCCGGGCGCCTCGACCGGCTGAGCGCCGAGCGCGGGCTGCCCATCG
CGCACGTGCTGCTGCGCGAGGGCGAGGCGTGGTGGAGCGAGACCGGCGTCGTCGGGCGCGACGTCCCGCC
GTGGGCGGCCGGGTGGCGGCGGCTGGCGGCCATGGAGGCCGTCCCGCGTACCGCCGGGCACGTCTCCGTG
TCGCCCGTCGCCGCGGCCGTGGTCGCCGGGCAGGTGGTGGCGGACCTGGGGCGCTGCCTGTCCGGAACGC
CCCGCGTGTCCGGCGGTCCGCGGCTGCACGTGGTGGACCTGGACGGGTTCGGGATGCGGACGCACTCCTT
CCTGCCGCACCTGTCGGCGCTGCCGCCCGGCACGGGGGTGAGCGCGGGGCCGCTCGGCGAGGAGGAGTTC
TCGCGGCGGGCGGCCAGGTTGATGGACTCGCGGACGGGGGTGTTCGCCGAGATCGAGGAGGGGGAGTACG
GGCAGCTCCCGCTGCACGTGTCGGTGACCACGGTGGCCGATCCGATGGGGGCCCTCGGGGGTGCGCTGGC
GCGGGTGATCGGCGTGGGGGCGGACTTCGCCACCGCGCGATACCGGGCGGCGCTTAAGGCACTGACCGTG
CACGGGCTGCTCGCCCTCGACCCCCGCCGCCTGGTCACGGCCGAGGGGACGCCCCTGACCGGCGCGGGGG
AACCCGCCAGCGGCTTCCCGGCTGATCCGGGCGCGAGGGAACGGCCGATCGGTGGCTTTTCGGCTGATCC
GGGTGCGGGTGAGCGGCCGGACGACGGTCTCCTGGACGACCCGCTGGTGGGCGACGTCGCGGCGGGACGG
GTCGAGGCGTTCGTGCGCGGCCGTGACCTCGTCGAGGGCGGTGAGGTGCTGCTGCCCGCCCGCGCGGTGT
TCCTGGATCCGCACGCCACCGGGGCCGCCGCGGGGTACTCGGCCGAGGAGGCGCTGGTCGCGGGGTTACT
GGACCACTGTGCGGCACTGGCCGGGCTCGACGGGACGCTGCCGCCCGTGGACGTGGGCGGCGCGCGGGCG
GCCGACGACGAGACCGCGCGGTCGGCGGCGCTGCTGGACGCGATCGGGCTGCCGTACCAGGTGCTGGACG
CCACCGGCCCGTCGGGCGTGCCCGTGCACGCGGGGACGCTCGGCGGGCGGCTGGTGGCGCGGGCGGCGGG
CGTCACGCCCCTGGCCGCGCTGCGGGCCACGCTCGAAGGGATCCTGGCCGCGTACCAGGGCATTCCGGGC
CCCGCACCCCTGCCCGACCTGTGCCCGGCCGTCGCGCAGGAGCCGCCGGTCGTCCTCGACACGGGGGCGG
CCGTGCTCGGCGCCGGTGAGCTCGCCGCCGCCCTGGCCGGCGCCGGGCTGCGGGTCAGCGCCGTTCCGCT
GGATCACGACCGGGAGGTACACGCGCTCATGCCGCACGTCGTCCGCGTCGTCACGGAGCCGCTCCATGGC
TGA
 Primer design

Protein Sequence:630 a.a.
>TpdF|ThioFinder225 Nonomuraea sp. Bp3714-39
MNDFKPRLPADIRFAPTSGGVAFLTREGVVRMNGASVHLWVERLAVHLDGSRTVAELTAELPDERRAFVT
SLLTTLRERGLVEDAGERGVLPVAAGTACSLLADADRFGELAPALADALRRLGLEVLTEPSGGALVHVAA
ADADGLAAAGRLDRLSAERGLPIAHVLLREGEAWWSETGVVGRDVPPWAAGWRRLAAMEAVPRTAGHVSV
SPVAAAVVAGQVVADLGRCLSGTPRVSGGPRLHVVDLDGFGMRTHSFLPHLSALPPGTGVSAGPLGEEEF
SRRAARLMDSRTGVFAEIEEGEYGQLPLHVSVTTVADPMGALGGALARVIGVGADFATARYRAALKALTV
HGLLALDPRRLVTAEGTPLTGAGEPASGFPADPGARERPIGGFSADPGAGERPDDGLLDDPLVGDVAAGR
VEAFVRGRDLVEGGEVLLPARAVFLDPHATGAAAGYSAEEALVAGLLDHCAALAGLDGTLPPVDVGGARA
ADDETARSAALLDAIGLPYQVLDATGPSGVPVHAGTLGGRLVARAAGVTPLAALRATLEGILAAYQGIPG
PAPLPDLCPAVAQEPPVVLDTGAAVLGAGELAAALAGAGLRVSAVPLDHDREVHALMPHVVRVVTEPLHG