Home 

Gene Symbol:  
tpdD
Organism:  
Nonomuraea sp. Bp3714-39
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
8287..9246 [1], 960 bp
Product Function:  
hypothetical protein
Product Locus:  
 ACS83784.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosO in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:960 bp
>tpdD|ThioFinder223 Nonomuraea sp. Bp3714-39
ATGACCTGGACGCGGCTGCGGGTGGACTATCACGACGGCCCGATGGACGACCTCATCCTGGACGCGCTCC
GCCCGGCCTGGCATGAAATACGGGGATATTTCCTGCGCCACTGGGTGTGCGGCCCGCACCTGCGGATCTT
CGTGGACGGCGACGCGACGCCGATCGTCCGGGCGGTCGAGCGCCACCTGGCCGCCTGCCCGTCCGCCGGC
ACCACCGACCCGCAGGCGCTGCTCCCCCTGCACGAGCGCCTGGCCGAGCTGGAAGGCGAACGAGGCCCGC
TGCTGCCATGGGCCCCCGACAACACCGTCACCGCCGAACCCCCGGGGCTCGACACCGAGCTCGACCGGTT
CCTCGCGGACTTCTACGCCGACACCACCGAGGCCGCGTTCGACGCCCTCGGCCGGGTCAGAGCCGGCACG
CCGCTGCCGGGCATCGCCTTCGACCTGGTGGTCGCCACCGCGCACGACCTGTCGGAGGGCGGCCTGCCCA
CTGCCAGGACCTCGCTGCGCTCGCACGCCGAGGCTTACCTGTCGCGCCTGCCGGGAGGCGTCCGCGCCAA
GTGGCAGGCGCACTACGAACGCAACCAGGAGCCGCTGACCGCCAGGATCAAGGCCCTGACCGGCGCCGGA
GAGCCCGGCGCGTGGCTGCGTACGATCCGGGCCACCCGCGACCGGGGCCGTACCCTCATCGACGAGGGAC
GGCTGAGCCTCGGCTACGCCACCGACGGCCCTTCCACGCGGCCCCCGCTCGCCGCGGTCTCCCCCTTCCA
CCGGAACCTGGAGACCGACGAACGCTGGCTCGCCCTCAAGGACACCCCCGCCTTCGCCGCCTACCGCCTG
GCCCTGAACTGCGCGTACCTCCACCTCACCCGGCTCGGCCTCACGCCCGACCAGCGCTTCCTGATCTGCC
ACCTCGCCGCGAGCGCCGCCGACGACGTCTACCGGGCCGTGGCCTCATGA
 Primer design

Protein Sequence:319 a.a.
>TpdD|ThioFinder223 Nonomuraea sp. Bp3714-39
MTWTRLRVDYHDGPMDDLILDALRPAWHEIRGYFLRHWVCGPHLRIFVDGDATPIVRAVERHLAACPSAG
TTDPQALLPLHERLAELEGERGPLLPWAPDNTVTAEPPGLDTELDRFLADFYADTTEAAFDALGRVRAGT
PLPGIAFDLVVATAHDLSEGGLPTARTSLRSHAEAYLSRLPGGVRAKWQAHYERNQEPLTARIKALTGAG
EPGAWLRTIRATRDRGRTLIDEGRLSLGYATDGPSTRPPLAAVSPFHRNLETDERWLALKDTPAFAAYRL
ALNCAYLHLTRLGLTPDQRFLICHLAASAADDVYRAVAS