Home 

Gene Symbol:  
tpdC
Organism:  
Nonomuraea sp. WU8817
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
12126..13025 [1], 900 bp
Product Function:  
dehydratase
Product Locus:  
 ACS83768.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosD in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:900 bp
>tpdC|ThioFinder237 Nonomuraea sp. WU8817
ATGACCGAACGGCCCGGCTGGTTCGCGGCGCATGTGCACTACCGCGGCGACCTCGACGCGCTGCTGCGCG
AAGCGGTCGCGCCGCTGGTGCGCGCGCTTGCCGCCGACTTCTTCTTCCTGCGCTACTGGGACGGGGGCAG
CCACCTGCGGCTGCGGCTGCGCGGCGGGGACCAGGTCGCGGTCGCCCGGCACCTGGACGCCTACCTTGCC
GCCCACCCCGCGCCGGAGACCACCTCCCAGGAGGAGTACGCCCGCGTCGCCCCGGTGCTGGCCGCCCGCG
AGGGCATGACGGGCCACCTGACGACGCTGCGGCCGAACAACACCGTGGAGTTCGCGGCGTACCGGCCGGA
GACCGCGAAGTACGGCACCGGCGACGCGCTACGCGCCGTCGAGCGGCATTTCGTCGAGTCCAGCCGGTAC
GCGCTTGACGTCCTTGACCGCCGCCCGACCGGCAACCAACGCGAGCTCGCAGTGCTCGGCGTCCTGCTGC
TCGCCTGGTACGCCGCCCGCCCACTCGATGAGCCGCCTGGTGAGCCGGTCGATGACGAGCTGATCGGCGC
GGTCGAGGCGCTGTGCCGGGGCTGGCGCGGCGGCCGGGACCTGCCCGAGGAGCTCGTGGCGGAGGAGTAC
GGCCGGGTGCGGGAGCGTGTGGCCGGGCTGGCCGGCGCGCTGCGTGACCTCGTTCCGGACCCGGACGCGC
CCGGCAGCAGCATGCGCGCGTGGGCGGCGACGTTCGACCGGCTCGCCGCCGCGCTGCCCCCGCCCGACCG
GCTGCGGGTGCTCGACACGTGCGCGCATCTGGCGGCCAACCGGCTGGGCGTGTCCATGGCGGCCGAGGTG
CGGCTGCGGCTGCTCGCCGCGCGGGCCCTGCGCGAGGTCGCGCCCGTGGGGAGGCGATGA
 Primer design

Protein Sequence:299 a.a.
>TpdC|ThioFinder237 Nonomuraea sp. WU8817
MTERPGWFAAHVHYRGDLDALLREAVAPLVRALAADFFFLRYWDGGSHLRLRLRGGDQVAVARHLDAYLA
AHPAPETTSQEEYARVAPVLAAREGMTGHLTTLRPNNTVEFAAYRPETAKYGTGDALRAVERHFVESSRY
ALDVLDRRPTGNQRELAVLGVLLLAWYAARPLDEPPGEPVDDELIGAVEALCRGWRGGRDLPEELVAEEY
GRVRERVAGLAGALRDLVPDPDAPGSSMRAWAATFDRLAAALPPPDRLRVLDTCAHLAANRLGVSMAAEV
RLRLLAARALREVAPVGRR