Home 

Gene Symbol:  
tpdB
Organism:  
Nonomuraea sp. WU8817
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
9646..12129 [1], 2484 bp
Product Function:  
dehydratase
Product Locus:  
 ACS83767.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosE in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:2484 bp
>tpdB|ThioFinder236 Nonomuraea sp. WU8817
GTGCCGCCGGCCCAGGCCGGCGGCACTCCGCCCGGGGTGAGGAGACAGATCATGGAGGTGGGCCGCGAAA
TCGTGGTCCGCGTGGCGGGGCTGCCCGCCGCCGTGCTCGCCGACCTGCGCCTGCCGCACACCGCCGAGCT
CGTCACGCACCTGTCCGCTGAGCGGCGGCGGCTCGCCGCCGAGGCGGCTGCGCTGTCCGGCGAGCTGTTC
GACCTGATCGGCGCCGCCGGCTCCGCCCGCGCCGCCCTGGTGGGCCTGCGGCGCGCGCTCGCCCCCGGGC
ACCGCCCCCCGTCGCCGCGACTGATCGGGCTGTGTCCCCTGCCCGCCCCGCTGGCCGAGCGGGTCACCGC
CTGGGTGCGGGCCCGGTACGACTGGGAGGACCGGCGCCGCGACCTTGCCGGCACGCTGGACAAGGAGCGC
GCCGACGCGCTCGACCGCGTACGCGCCGCCTGCGTCGCCCCGGCGTTCCGGCGGGGTCTGGCGCTGTCCG
GTGGGGAGCTGACCAGCACGCTGGAGCGCTGGCTCGCCGACCCCGGCCGTGCGCCCCGGCAGGGGAAGGT
GCTCCGCCTGGTCAAGTACCTGACCCGAGCTGCGGCCAAGACCAGCCCGTACGGCTCCTTCATGGTCAGC
GCGCTGGCGGGGCGGCCCGGCGACGACCCTCCCATCCCGGAGCTGCTCACCGTGGCCGAGCCGCCGGGGG
CGTTCCTCGACGCCGTCGGCGACGCGCTGCTCGCCGACCCGGCACTGGCCGGCCAGGTGCCGCTGCGCCC
CAACCCCAGCCTGACGTGGACCGCCCAAGGACTGCTTTTCGTCCGGACCGTCCGCGCGGCGGCGGGAGAG
CAGGCCGGGCCGAAGGAAGAGATCGCCACCGCCGGGCGCGCCGCCGCGCTGGAGCTGTGCCTGCGGCACG
CCGAGTCCCGGCCCACCGCGCCGCAGCTGGCGGAGCTGCTGGCCGAGGCGGGGGCGGATCCGGGCGAGGC
GGCCGCGTTCGTCGACCGGCTGGTGGCGGCGCAGCTCCTGCTGCCGTGTCCGCCGGTGCACGACGACGAT
CCCGACCCGTTCGGTGCCTGGGCCCGCCAGGTGTGCGCCCCGGAGCTGCGCGAGCTGGCGGCCGCGTCGC
GGCCCGTGGCCGCCGCCGTGGACTCGCCCGGCCAGCGCCGCGCCAGGATCGCCGAAGCCGCCGCCGCCGT
GGCGGACCGGCTCGGCATCGACCCGCCCGCCGATCCGGCGCACGAGCACGACGTCAGCACCGGCCGTCCG
GCGCCGCCACCGCTGCCCGCGGGCGTGCTCGCCGACCTGGACGCGGTCCGGCGCTGGCTCGCCGTGTTCG
ACTGGAAGGTGCCCGTCCGGGTGGGGGTCGGCGCGTTCTGCCGCGAACGTTTCGGCTCAGGGTCCCGCAC
GCCCTTCCTGGAGGCGTGCCGGGCGGCGACGGCGGCGCTGCCGCACCTGTTCGGCCCCGCCGCGATGCCG
TGGTTCCTCGACCTGACCGGTGACGGTCGCCTGCGTGAGCTGGACCGTCTCCGGACGCGCGCCCGCGATC
TCGCCCGCTCCGGCGTCCTCGACCGGCGGCGGGTGCTGGCTGACACGGCCGACTGGCCCGCCTGGCTGAC
CTGGCCCGCCTCCACTGGTTTCTACCTGCAGACCCTGCCCGGTGGGGTGGTGCTGAACGCGGTGCATGCC
GGGCACGGCCGCGCGGCGGGTCGCGTCCACCACCTCCTCGCCCGGGCGGGCGCCGCGCCGCCGCGCCCGC
CCCGCTCCGGCCTGCCGCGTGCCGAGTTCGGCGGCAGGTTCGGCTCCGCGCTCAACACCCGCACGCCGAG
CACGCGGTACGAGATCGACCACCCCGGCGCGACGTCCGGCCGCGACCCCCGGCACCGTGTCCCGCTCGGC
ACGCTCATGGTGGTGCACGACCCGGACACCGACCTGGTCCACCTGCACAGCGACCGGCTCGGCCGCGTCG
AACCGGTGCACCTCGGCATGATGGGCGAGCTGGGGCTGCCCGCCGTGGCCGGTTTCCTCGAACGCGCCTT
CGCGCCCACCTACCTGTTCCACCCGAGCGTGCCGCCGTTCATCTCGCTGCGTGACCTGGCCGGCGCCTCC
TCGGCGCGGCGCTTCCCCAGGGTGAGTGTCGGCGACGTGGTCGTGCAGCGCGCCCGCTGGACGGTGCCCG
CCGGCCTGGTGCCCGCGCGTACCGGGGCGGACGGTGACCACCTGCTCGCGCTGGCCGAGTGGCGGCGCGA
GCACGGCATCCCCGAGCGGTGTTTCGTGCGCGGCTGGAAGCCGGGCGCAGCGCTGGGCAAGGCGCGCAAG
CCGCTCTACGTCGACTTCGCCTCCTGGCATCTGGTCGCCCTGTTCGAACGGGAGGCGCGAACCAACGCCG
CCCTGGTCATCGACGAGGCCCTGCCGGACCCGCTGGCCGACGGCGCCCCCGCGCACGTCACCGAGTACCA
CGTCGAGATCGGCGACCGGGAGAGAGAGCAATGA
 Primer design

Protein Sequence:827 a.a.
>TpdB|ThioFinder236 Nonomuraea sp. WU8817
MPPAQAGGTPPGVRRQIMEVGREIVVRVAGLPAAVLADLRLPHTAELVTHLSAERRRLAAEAAALSGELF
DLIGAAGSARAALVGLRRALAPGHRPPSPRLIGLCPLPAPLAERVTAWVRARYDWEDRRRDLAGTLDKER
ADALDRVRAACVAPAFRRGLALSGGELTSTLERWLADPGRAPRQGKVLRLVKYLTRAAAKTSPYGSFMVS
ALAGRPGDDPPIPELLTVAEPPGAFLDAVGDALLADPALAGQVPLRPNPSLTWTAQGLLFVRTVRAAAGE
QAGPKEEIATAGRAAALELCLRHAESRPTAPQLAELLAEAGADPGEAAAFVDRLVAAQLLLPCPPVHDDD
PDPFGAWARQVCAPELRELAAASRPVAAAVDSPGQRRARIAEAAAAVADRLGIDPPADPAHEHDVSTGRP
APPPLPAGVLADLDAVRRWLAVFDWKVPVRVGVGAFCRERFGSGSRTPFLEACRAATAALPHLFGPAAMP
WFLDLTGDGRLRELDRLRTRARDLARSGVLDRRRVLADTADWPAWLTWPASTGFYLQTLPGGVVLNAVHA
GHGRAAGRVHHLLARAGAAPPRPPRSGLPRAEFGGRFGSALNTRTPSTRYEIDHPGATSGRDPRHRVPLG
TLMVVHDPDTDLVHLHSDRLGRVEPVHLGMMGELGLPAVAGFLERAFAPTYLFHPSVPPFISLRDLAGAS
SARRFPRVSVGDVVVQRARWTVPAGLVPARTGADGDHLLALAEWRREHGIPERCFVRGWKPGAALGKARK
PLYVDFASWHLVALFEREARTNAALVIDEALPDPLADGAPAHVTEYHVEIGDREREQ