Home 

Gene Symbol:  
tpdE
Organism:  
Nonomuraea sp. WU8817
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
14023..15390 [1], 1368 bp
Product Function:  
dehydrogenase
Product Locus:  
 ACS83770.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosF in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:1368 bp
>tpdE|ThioFinder239 Nonomuraea sp. WU8817
GTGATGTCAGTACAGGTCGAGCCCGCAGTGACGCACCGGTGGGCACTGCGGCCCGGCGTCTACCGGGCCA
CCGCGCCAGGCGGCGATCTCATGCTCGCCGCCTGGCCGCACGCCACGCCGCTCGGCCGGGCCACCCCCGA
GCTGCTGGCCCTGCTGGACGGCCTGGCCGCCGGATCGCTGCCGCTCGACGAGCCCGGCGACCTCGCGCCC
GCCGTCGAGCTGCTGCGCGCGGGTGGCTGGCTGCGCAAGACGGTGGCGTACGCGGGACGCGACCTCTACA
CCATCACCCCCGTCGCCGCCCCCACCGACGCGCCGCCACCGCCGCGGGACGAACCGGCGCTGTCGCGGTT
CGCGCTGCTGCGCAACACCGCGGACGGGCTGGTGCTGGAGATGCCCGGCTCCTGGTGCGACGTCCACGTG
CACGACCCGGCGGTGGCCGCGCTGCTCGCCGACCCGTCCGGCGACGGCGGCCTGCCCGCCGAGGCCGCGG
CCGCGCTGCGCGCCGACCTGGCCGCCGCCGGCATGCTGATGGAGCGGGAGGAGCCGTTCGAGCGGCGGCA
GTGGAGCACCCACGAGCTGTGGTTCCATGAACGCAGCCGGCTCGGCAACCGGGGCTGGTTCGGCGCGCAC
TTCGGCGGCACGTTCTGGGCCCGCGGCCGGCACGACCCGCCGCCCGCGCGGCCGTCCCCCTACCCCGGCC
CGGCCGTCGAGCTGGCCCGGCCGGACCTCGCGGCGCTGCGGCGCACCGACCCCACGCTCACCGCCGTGCT
GGAGGACCGCGAAAGCGTCCGCGACCACGACGACGACGATCCGATCAGCGCTGAGCAGCTCGGCGAGCTG
CTCTACCGGTGCGCGCGGGTGCGGCTGCTGCGTCACCTGGAAGGCTTCGAGTACGCCGGCAAGCCGTACC
CCGCCGGTGGCTCGGCGTACGAGCTAGAGGTGTACCCGGTCGTGCGGCTGGCCCGCGGCCTCGACCCCGG
CATGTACCACTACGACGCGCACGACCATCGGCTGCGCCAGGTCCGGCCCGCCGGCCACCCGGCGGTGCGC
AGGATGCTGAAGGTCGCCACGGAGTCGTCCGTCGCCAAGGCGCCGCCCCAGGTGCTGCTGGTGATCAGCG
CGAGAGTCGGCCGGATCCTGTGGAAGTACGAGGCGATGGGGTACGCGCTCATGCTGAAGCACGTCGGCGT
GCTGCAACAGACGCTGTACGCGGTCGCCACCGCCATGGACCTGGCCCCGTGCGCGCTCGGCAGCGGGGAC
GATCTCGCCTTCACCGCCGCCACCGGCCGGGACCGGCTGGTGGAGTGCGCGGTCGGCGAGTTCATGGTCG
GCAGCAGGCGGAAGGAGCCCGCGGCATGGGAGCTCTGA
 Primer design

Protein Sequence:455 a.a.
>TpdE|ThioFinder239 Nonomuraea sp. WU8817
MMSVQVEPAVTHRWALRPGVYRATAPGGDLMLAAWPHATPLGRATPELLALLDGLAAGSLPLDEPGDLAP
AVELLRAGGWLRKTVAYAGRDLYTITPVAAPTDAPPPPRDEPALSRFALLRNTADGLVLEMPGSWCDVHV
HDPAVAALLADPSGDGGLPAEAAAALRADLAAAGMLMEREEPFERRQWSTHELWFHERSRLGNRGWFGAH
FGGTFWARGRHDPPPARPSPYPGPAVELARPDLAALRRTDPTLTAVLEDRESVRDHDDDDPISAEQLGEL
LYRCARVRLLRHLEGFEYAGKPYPAGGSAYELEVYPVVRLARGLDPGMYHYDAHDHRLRQVRPAGHPAVR
RMLKVATESSVAKAPPQVLLVISARVGRILWKYEAMGYALMLKHVGVLQQTLYAVATAMDLAPCALGSGD
DLAFTAATGRDRLVECAVGEFMVGSRRKEPAAWEL