Home 

Gene Symbol:  
tpdG
Organism:  
Nonomuraea sp. WU8817
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
17201..18937 [1], 1737 bp
Product Function:  
cyclodehydratase
Product Locus:  
 ACS83772.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosG in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:1737 bp
>tpdG|ThioFinder241 Nonomuraea sp. WU8817
ATGATCCGCCTGCCCGACCACGGCGAGCTTGCCGTGCCGATCGGCGACGGGCCGATGCTGCCGCTGCGCA
CCGAACTCGGCCGGGTGGTCATCGGCCCGCTGGAGCGGCCCGGCGTGCCCGGATGCCGGGCCTGCGTGCG
CATCCGCGCGGCGCGGGTCCAGCCCGACGCCCGCAAGGCCGAGGCCGTACGCGCCCGGCACGCCCCCGCG
CCCAGCCAGTGGCTCACCCCGCTCGCCACCGACCTGGTGCGCGTCCTGGTCGCGAGCGAGAGCGCTGCCC
TGGCAGCCGACACCGACCCCCGCACCGCGGGTGCCGTGCTGGAGATCGACCTCGCCACGCTGGAAATCAC
CAGGCACCGGTTCCTGCCCGACCCGCTCTGCCCGCACTGCGGCGGTCTGCCGCCGGACGGCCCGGCCGAG
CTGACCCTGCGGCCCCGCCGCAAGCTCGGCGGCAGTCCCCGGACCAGGCCGGTCGAGCTGAACGCGCTGC
TGGAGACGTACGTGGACGGCCGGGTCGGGATGATCCGGCCGCTGAAGTCGGGCGTGCAGGGCGGACTGAC
GGTGGCCAGCGCCATGCTGCCGATCCGCGCGGGCCACGGCCTGGAACCGGGGGTCGGCCGTACCCGCAGC
TACACCGCGAGCAGGCTGGTCGCCGTGCTGGAGGCGCTGGAGCGCTATGGCGGCGTCAGCCCCGGCGGCC
GCCGCACCAGCGTTACCGCCGCCTACCGCGACATCTCCGGCCACGCCGTCCATCCCGACACCTTCGGCAC
ACACCCCGAGGAGAACTACGACAGGCCCGGCTTCGCCTTCCGGCGCTTCACCGAGGACACCGTGTGCCGG
TGGGTGTGGGGCTACTCCTTCGCCAAGGCCCAGCCCGTGCTGGTGCCGGAGAACCAGGTCTACTACTACG
CCAGAAACCTGCCGGACGGCGAGCAGCCGTTCGTCTTCGAGGTCTCCAACGGCTGCGCGCTCGGCTCGTG
CCTGGAGGAGGCGATCCTGCACGGCCTGCTCGAGGTGGTCGAGCGGGACGCGTTCCTGCTCACCTGGCAC
GCCCGGCGGGAGGTTCCGGTGCTGAACCCCGCGCTGGCGAGCGACCCGGTCCTGCCCATGCAGGCCGCCG
CGATCACCGCCGAGACCGGGCACCGGGTGCTGTGCTTCGACACCACCGCCGAGCACGGCATCCCCAGCGT
GTGGGCGATGGCCGTGGACGTCGAACACCGGTCGGACCGGCCCGCCACCGCCCACGCCGCCGGCGCGGCG
CTCACGCTGGAGCAGGCCGCCATGAACGCGCTGAGCGAGCTCGGCCCGCTGCTGGCCGACGTGATCCGCC
GCTACCCCGAGGAGCGGGAACGGGCCGAGGCCATGGTCCGCGACCCCGAGCAGGTCGCCACCATGCACGA
CCACTCCCTGCTCTACGCGGTTCCCGCCGCGGCCGAACGGCTGTCGTTCCTCACCGGCCGCGCCGACGGC
CCGCGGACCGGCTTCGGCTCGGCCCGGTTCACCGGCGACGACCTCACCGCCGATCTGCGGGCCATGATCG
ACGCGGTGATCGACGCCGGGATGGACGTGGTGGTCGTCGACCAGACCACGCCGGAGCACCTGGCGGGCGG
GTTCCGCTGCGTGAAGGTGCTGGTGCCCGGCGCGCTGCCGATGACGTTCGGCCACCAGTACCGGCGGCTG
GACAACCTGCCGCGGCTGGCGGCCGCGCGTACCACCGACCCGCACCCGTTCCCATGA
 Primer design

Protein Sequence:578 a.a.
>TpdG|ThioFinder241 Nonomuraea sp. WU8817
MIRLPDHGELAVPIGDGPMLPLRTELGRVVIGPLERPGVPGCRACVRIRAARVQPDARKAEAVRARHAPA
PSQWLTPLATDLVRVLVASESAALAADTDPRTAGAVLEIDLATLEITRHRFLPDPLCPHCGGLPPDGPAE
LTLRPRRKLGGSPRTRPVELNALLETYVDGRVGMIRPLKSGVQGGLTVASAMLPIRAGHGLEPGVGRTRS
YTASRLVAVLEALERYGGVSPGGRRTSVTAAYRDISGHAVHPDTFGTHPEENYDRPGFAFRRFTEDTVCR
WVWGYSFAKAQPVLVPENQVYYYARNLPDGEQPFVFEVSNGCALGSCLEEAILHGLLEVVERDAFLLTWH
ARREVPVLNPALASDPVLPMQAAAITAETGHRVLCFDTTAEHGIPSVWAMAVDVEHRSDRPATAHAAGAA
LTLEQAAMNALSELGPLLADVIRRYPEERERAEAMVRDPEQVATMHDHSLLYAVPAAAERLSFLTGRADG
PRTGFGSARFTGDDLTADLRAMIDAVIDAGMDVVVVDQTTPEHLAGGFRCVKVLVPGALPMTFGHQYRRL
DNLPRLAAARTTDPHPFP