Home 

Gene Symbol:  
tpdF
Organism:  
Nonomuraea sp. WU8817
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
15378..17204 [1], 1827 bp
Product Function:  
hypothetical protein
Product Locus:  
 ACS83771.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosH in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:1827 bp
>tpdF|ThioFinder240 Nonomuraea sp. WU8817
ATGGGAGCTCTGAACCTCCTCCTGCGCCCCGACGCGCACTACGCCGAGGTCGACGGCGGCGTCTACGTGC
TGAGCCACCAGGGCGAGACCTTCATCTCGGGCACCTCGGTGCACCGGTGGCTCGACCGCCTCGCGCCGCT
GCTCGACGGCACCCGCACGCTCGACCAGCTCACCGCCGGCCTGCCCGCCGACCGGGCCGGCTTCGTGGCC
AGACTTGTCGGCACGCTCACCGAACGCGGCCTGGTGCGCGAGGTCGGCCCGGCGGTGTCGGACACGCTCA
CCGACGCCGAACGCGGCGAGCACCGTGCCCTGCTGGCCTACCTGGGCTACTTCCACGACTCGCCCGGCCG
CGTCCTCGAGGACGTGCGCGACACCCCGACCGCGATCGTGGGGTCCGGTCCGCTGGCCGCCGCGGTGGTC
CGCGCCTGCGCCGCCGCCGGGCTGCGCCGGGTGGAGATCGGCGAGGAGGCGGGCGCGGCCCGGGTGGTCG
TCCACGTGGCCGAGCGCGCCGAGCCCGAACGGGCGGCGCGGCTGGAACGGCGGTGCGCCGCCGAGGGGGT
GCTGCTCGCACAGGTCATGCCGGGGCCGGACGGCATCTGGTGGCAGCCCGCGGCCCGCGGCGGCTGCTGG
GCGAGCGCGTGGCGCCGCCACCGGGCGCTCGCGGGCGTGGATCGGACGGGCACGCCGCTCGATCCGGTGG
CGGTCGCGGTGGTGGCCGGCCAGGTGGCACACGACGTCTTCCGCGTCCTCGCCGGACTGCGCGAGGAGGC
GCCGCCCCGGTTGGTGGTGCTCGATCCGCGGACGCTGGCGAGCACCGCGCACCCGGTGGTGGCGCACCCG
TTCGAGCTGCCCGCCGCGCCGCTGGACGAGGCGGCGTTCCTCGACCGGGTCGCCGCGCTGCGGGCAGCGC
CCGCGCTGAGCGAGGCGGAGTTCTCCCGGCGGGCCAAGGGGCTCATGGACTCGACAGTGGGGCTGTTCGC
CGAGATCGACGAGGGCGACCTCGCGCAGTTGCCGCTGCACGTCACGGCGACCACGGTGGCCGACCCGTGC
GGGCTGATCGGCTCCGCGCCGCGGCCCGTGGTCACCGGCGCGGGGCTCACGTTCGAGGAGGCCCGCTACC
GCGCGGCGCGCGCCGCGCTCGCCCTGGCCGGCACTCTCGCGCTCGACCGGCGGAGGCTGGTCGACGGCCG
GGTGTGGGCGTACGACCTTGCGGACGGGGCCGCCCGGCTGGTTCCGGCCGACGAGGTCTTCGCAAGCACG
GCGGGCGGGAGCACGGCGGGCGTGCCGCTCGGCGCGGCGGCAGCCTACTCGTGGGCCGAGGCGGTCGCGG
AGGGCCTGGTCGCGCAGGCCGCCGCGCTCACTCTCGCCGGCGCCGGGCACGCGGGCGAGCCGTATGGACG
GGCGGACCTCGCCGGGGCGCCTGCGTATCTCCTCGCCATGGTGCGGGCGCTCGGCGAGGAGCTGACCGTG
CACGACGTCACCGGGCCGCTGGGCGTGCCGGTCGTGGTGGGGACGCTGTCCGGCGGGGCGACCGCCTGCG
GCGCGGGCATGACCACGGACGCCGCCGTCACCGCGTGCCTGCGCGACCTGCTGCTGCTGCGCCAGGCCGA
GATCAACGACCAGCCCGTCTACGCCCCACCATCCGGCAGGCCCTTGCCCGGGCATCTACGCGGGAACCAC
CCGGCGCCCGCCGTGCCCGGCACGGACGCCGACCGGCTGGCGGCCCGCCTGGCCGAGCGGGGGCACCGCC
CTCTGGCGGTGCCGCTGGATCATGACCAGGCCGTGCACGCGGTCCTGCCCTTCGCCGTCCGGGTGGTGTG
CCGATGA
 Primer design

Protein Sequence:608 a.a.
>TpdF|ThioFinder240 Nonomuraea sp. WU8817
MGALNLLLRPDAHYAEVDGGVYVLSHQGETFISGTSVHRWLDRLAPLLDGTRTLDQLTAGLPADRAGFVA
RLVGTLTERGLVREVGPAVSDTLTDAERGEHRALLAYLGYFHDSPGRVLEDVRDTPTAIVGSGPLAAAVV
RACAAAGLRRVEIGEEAGAARVVVHVAERAEPERAARLERRCAAEGVLLAQVMPGPDGIWWQPAARGGCW
ASAWRRHRALAGVDRTGTPLDPVAVAVVAGQVAHDVFRVLAGLREEAPPRLVVLDPRTLASTAHPVVAHP
FELPAAPLDEAAFLDRVAALRAAPALSEAEFSRRAKGLMDSTVGLFAEIDEGDLAQLPLHVTATTVADPC
GLIGSAPRPVVTGAGLTFEEARYRAARAALALAGTLALDRRRLVDGRVWAYDLADGAARLVPADEVFAST
AGGSTAGVPLGAAAAYSWAEAVAEGLVAQAAALTLAGAGHAGEPYGRADLAGAPAYLLAMVRALGEELTV
HDVTGPLGVPVVVGTLSGGATACGAGMTTDAAVTACLRDLLLLRQAEINDQPVYAPPSGRPLPGHLRGNH
PAPAVPGTDADRLAARLAERGHRPLAVPLDHDQAVHAVLPFAVRVVCR