Home 

Gene Symbol:  
tpdD
Organism:  
Nonomuraea sp. WU8817
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
13025..14026 [1], 1002 bp
Product Function:  
hypothetical protein
Product Locus:  
 ACS83769.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosO in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:1002 bp
>tpdD|ThioFinder238 Nonomuraea sp. WU8817
ATGAGCTGGCGACGCGTCGACGTGGCCTACCACGATCCCGACCTTGACGGGCTGATCCTGGCCACCCGGC
CGCTGCTGGCCGGGACGCCCGGCCGCGGCTGGTTCCAGCGGCACTGGGTCCGCGGTCCGCACCTGGAGCT
GTGGTTCGACGCCGCGCAGCCGTCGTGGGAGCGGATCCGCGACGTGCTGGAGCCCTGGCTGCGCGTCAAC
CCGTCGCGCGCCCGGATCGACCGAGACCGGCTGCTGGCGCAGCACCGGCACCTCGCCGCCGCCGAACGGA
TCGACGAGCCGCTGCTGCCGTTCTACGCCGACAACACGCTGCACCGGGCCGCTCCGCGCTCCCGCGCACA
CGTGCTCGGTGGTCCGGCGGCCGAGGAGCTGTTCCACGACTTCCACACCACCGCCAGCGCCGTGGCTTAC
GACGAGCTCGACGCCGTGCGGGCGGGAGAGTCGCGGCTGGTGATGGCACTGGACCTGATGGTCGCCGCCG
CGCACGCGCACGCCGAGGGCGGCGTCCGCGGCGGGTTCGTGTCGTTCCGCTCGCACGCGGAGGCGTTCCT
GGCGAGCGCGCCCGGCCTGCGCGAGCGCTGGGACGCCGAGTACGCCGCCCGGGCGGGGGCGCTGCGAGCG
CGGATCACCGCGGTGGTCGCCGGAATCCCGCGCGGCCGGGCGTGGGCCGGGCTGCTCGACCGGTTCGCGG
ACCGCGGCGACGAGCTGATCGCCTCCGGCGCGCTGCTGGTCGAGCCCGCCGGGCCGGACGCGGTCGCCCG
GCCCGACACCGCCTTCCACCGGGCGCTGCGCGGCAACCGGACCTGGCACGAGGAGGTGCTGCGCTCAGCA
CCGTTCCGCCGCTACCGGCTGCTGCTGAACCTGACCTACCTGCAGCTTTCCCGGCTCGGGGTGAACGCCG
TGCAGCGGGCGCTGCTGTGCCACTTCGCCGCGTCGGCGGTCGAGCAGGAGTACGGGGTGTCCGCCATCGA
GATCGCCATGGGAGGCGCGTGA
 Primer design

Protein Sequence:333 a.a.
>TpdD|ThioFinder238 Nonomuraea sp. WU8817
MSWRRVDVAYHDPDLDGLILATRPLLAGTPGRGWFQRHWVRGPHLELWFDAAQPSWERIRDVLEPWLRVN
PSRARIDRDRLLAQHRHLAAAERIDEPLLPFYADNTLHRAAPRSRAHVLGGPAAEELFHDFHTTASAVAY
DELDAVRAGESRLVMALDLMVAAAHAHAEGGVRGGFVSFRSHAEAFLASAPGLRERWDAEYAARAGALRA
RITAVVAGIPRGRAWAGLLDRFADRGDELIASGALLVEPAGPDAVARPDTAFHRALRGNRTWHEEVLRSA
PFRRYRLLLNLTYLQLSRLGVNAVQRALLCHFAASAVEQEYGVSAIEIAMGGA