Home 

Gene Symbol:  
tpaL
Organism:  
Nocardiopsis sp. TFS65-07
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
29497..30369 [1], 873 bp
Product Function:  
putative dehydratase
Product Locus:  
 ADO67782.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosD in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:873 bp
>tpaL|ThioFinder198 Nocardiopsis sp. TFS65-07
GTGTACCTGCCCTACTCACTGCAGACCGCCTTCCTATGTGAAGACGTGGCGCCTCTGGTCGGGGACCTGG
GGGCACGCGGTCGCTTCTTCTTCCTGCGCTACTGGAAGGGCGGGCCGCACCTGCGGCTCCGGTTCGACGG
TCGCCACACGCAGGTCGGTCCTGAGGAGGTCGTCGAGCGTCTGGAGTCGCTGGTCCCCCACGGGGACCAG
GAGGCCAGGGGCCAGTACGACCTCCAGGCCGCTTCCCAGGCCGGACTTGCTCGTATGGAGAACGAGGAGG
TCATGGCGGCCAGGCCCTTCGGTGCCGTGGAGCGCTTCGACTACCTCCCCGAGTACGACAAGTACGGCGG
GCCACAGGGGATCGAGATCGCCGAGACCGTGTTCTGTGACACCTCGGGGGCGGTCTTGGACCTCCTGGCG
GCCACCAGGAGGTCGACCACGATGCCCGTCGGCGAGGCAGTGCGGGCCATGGCCATGTCCCTGCGCGGCG
TGGGCTTGAGCGCGGAGGAGAGTGTCCCCTTGCTGCGCGGCTACGAACAGCGGTGGAGCGCCTTCCTGCC
GGAGAGCTCCGATGCCGGTTGGAACTCCATGTACGACAAGGCGAGGGACGGTCTGGTGAACATGTGCAGA
AAGATCTGGGGCCCGACCGAGGGCGACGCCTTCTCCGATGCCTACGCGACCGCGACCGCGAGGGCCCGGG
CGCTGTTCGGGGAGGGGCCCGACCAGAGGTTGACCGACATCAGGATGCCGGGAACCTCCTACATGGAGTG
CGTGGCGCAGTACCTCCACACGACCAACAACCGCCTGGGGCTGGTCCCCGCAGGTGAGGCGCTCGCGGCC
CATCTCATGCACTGTGCCCTCCGGGAGCTGTGA
 Primer design

Protein Sequence:290 a.a.
>TpaL|ThioFinder198 Nocardiopsis sp. TFS65-07
MYLPYSLQTAFLCEDVAPLVGDLGARGRFFFLRYWKGGPHLRLRFDGRHTQVGPEEVVERLESLVPHGDQ
EARGQYDLQAASQAGLARMENEEVMAARPFGAVERFDYLPEYDKYGGPQGIEIAETVFCDTSGAVLDLLA
ATRRSTTMPVGEAVRAMAMSLRGVGLSAEESVPLLRGYEQRWSAFLPESSDAGWNSMYDKARDGLVNMCR
KIWGPTEGDAFSDAYATATARARALFGEGPDQRLTDIRMPGTSYMECVAQYLHTTNNRLGLVPAGEALAA
HLMHCALREL