Home 

Gene Symbol:  
tpaB
Organism:  
Nocardiopsis sp. TFS65-07
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
14689..15756 [1], 1068 bp
Product Function:  
TpaB
Product Locus:  
 ADO67771.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosO in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:1068 bp
>tpaB|ThioFinder187 Nocardiopsis sp. TFS65-07
ATGTCCAAATACGACCTATCGGTCGCGGACCGGTACCGCTCTATGGTCTCGGAGCTCTTCTCCCGCGGTG
GCCGGCTCCCCATCGGTGACCACTACTTCCTTCGGACCTGGGACCAGCGGACAGCGGGCGAGTGTGTCCA
GGCGGTCATCGAAGTCGAGGACGCCGAGGCCCCGGGGGTTCTCGATGTGGTCAACGGGGTGGCCAGGGAG
AACGGTTTCGAGGCGGACGTCCGGGAGACTCCGCCGGCAGAGGTGCCTTCCCCGCTCTGGAACGTCGGGT
TCGCTGGGATCTCCTTCGACCGTGTCTCCAAGGCGCTTTACCGGGACGCCTCACCTCTGGCATCCGAGTT
CGCCGGGGCGGCACGGGAGAGCGTGGGGGGCGCGTACCGCCTCGCGCTACGCCTCATGGCCGAGCATGAC
AAGGCCACCCTGGTTGGTTCCGAACAGCGCGGGGTCAGTCCGCTCGGTTTCGGTGATCTTCTTTCCACGC
GGCTGTTGAGCTTTCGCTCGCACTATGAGGGTATGGCCGCCAGGGTGAGGGACCGGGAGTCCTTCGAGGG
GCGTTGCGAGAAGTACTACGAGGATTTCGGGCACTATGCCAGGGGGCTGGTCTCCTCCTGTATGGAAAGT
GAAAATCCTACCGATGATCCTCATATGCGGCAGTGGGCATTGAACATATCCGAGACCACGAAGCCGCTGC
GTGAGGAAGTTCGCGAAGGTCGAATCGTCAATGTCGGCCTCACGCTCGACGATCTTAACCGTGATCGTGA
AACCCTTCTTTCGCCGGCCGGTTTCCACGCTTTCGGTGCTGATTCCGAGGCTTTTCAGTACCTCATGAAC
AGCGATCCAGATTTCATGGCCTTTCGAATCCAGGCCGGCCTTCTCTATAGCTGCCTGCACACGATCGGTT
TCAGTCTGCCGGAGCGCTTCGTGCTCTGTTATATCCTCGGGCGCGCCAATGAGGACGTGTCCGGTAAATC
CGCGAACGAACTCCAGGAGCGGCTGATGTCCGTCGCGGAGGGGATGTACGCACGGACCGACCCGGCCCGG
GAGGGACAGTGGTCCTGA
 Primer design

Protein Sequence:355 a.a.
>TpaB|ThioFinder187 Nocardiopsis sp. TFS65-07
MSKYDLSVADRYRSMVSELFSRGGRLPIGDHYFLRTWDQRTAGECVQAVIEVEDAEAPGVLDVVNGVARE
NGFEADVRETPPAEVPSPLWNVGFAGISFDRVSKALYRDASPLASEFAGAARESVGGAYRLALRLMAEHD
KATLVGSEQRGVSPLGFGDLLSTRLLSFRSHYEGMAARVRDRESFEGRCEKYYEDFGHYARGLVSSCMES
ENPTDDPHMRQWALNISETTKPLREEVREGRIVNVGLTLDDLNRDRETLLSPAGFHAFGADSEAFQYLMN
SDPDFMAFRIQAGLLYSCLHTIGFSLPERFVLCYILGRANEDVSGKSANELQERLMSVAEGMYARTDPAR
EGQWS