Home 

Gene Symbol:  
BC5083
Organism:  
Bacillus cereus ATCC 14579
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
4989031..4990002 [-1], 972 bp
Product Function:  
lantibiotic biosynthesis protein
Product Locus:  
 NP_834751.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosD in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:972 bp
>BC5083|ThioFinder257 Bacillus cereus ATCC 14579
ATGAACGAGAATAATTTTATATGGAAGGCTTATCATATTTTTTATCATCAAAATCAAGATTTTCTAATTA
CAAATTGTATCAAACCAATTTTAGATGAATTGATAAAAAAGAAATTAATTAGTAAATTTTTTTTTATAAG
ATATTGGGAAGGCGGACCTCATATTAGAGTGCGACTTTATTGTACATTAAATAAATCTCAAGAAGTTGAT
TATAAATTTAATGATTTTGTTTCTAAATTCTTGAAAACATATCCTTCTTCATCAACATTAGATAGAAACA
TGATAAAGAATCAATTAGCAAAATTAGCTAGTCTTGAAGAGGGTACTGAGTCAACATGTGTTCGAGAGAA
TAATCATATTATTCATCTAGAATATAATCCAGAGTATAAACGATATGGAGGAGAAAATGGAATAGAGATT
GCGGAAGAACATTTTTACCATTCAAGTATAATGTGTTTGAAGTTAATACAAGAAATTAATAAAAAGACAA
ATCGTTTGCGCATATCTATTGAAATTATACTATCTTATTTAAAAGCTATGAATATGAACTTACAAGAGAG
TATTAAGTTTTTAGAAGGCTATTATCTAATATGGAAAAGATATGTATACAGCAATACCAATAACGTTGAA
GAATTCTTCGCTAACAAATATATTAAGCAAAAAAAAGTAATAGACAAAATTGTAGTAAACTATTTCAATT
CTAATAATAATAAAGGTATGTTAGGAGAAAAATGGAGTAATCATTTGAATTTAACTGTACAGAATTTAGA
AAATGATTGGGATCGGGGAGAATTAATAATAGATAAAGATGTTTTAGCATATATAAATATCCCTCAAAAG
ATTGCTTTTATAGTTACAAGTTATGTTCATATGACAAACAATAGGCTTGGTATCATGCCGCAAGAAGAAG
CCTATTTAAGCTATATGCTTTTATGTAGTTTGAAATCATTGTATAAGAGTAGAAAGGGATGA
 Primer design

Protein Sequence:323 a.a.
>BC5083|ThioFinder257 Bacillus cereus ATCC 14579
MNENNFIWKAYHIFYHQNQDFLITNCIKPILDELIKKKLISKFFFIRYWEGGPHIRVRLYCTLNKSQEVD
YKFNDFVSKFLKTYPSSSTLDRNMIKNQLAKLASLEEGTESTCVRENNHIIHLEYNPEYKRYGGENGIEI
AEEHFYHSSIMCLKLIQEINKKTNRLRISIEIILSYLKAMNMNLQESIKFLEGYYLIWKRYVYSNTNNVE
EFFANKYIKQKKVIDKIVVNYFNSNNNKGMLGEKWSNHLNLTVQNLENDWDRGELIIDKDVLAYINIPQK
IAFIVTSYVHMTNNRLGIMPQEEAYLSYMLLCSLKSLYKSRKG