Home 

Gene Symbol:  
BC5084
Organism:  
Bacillus cereus ATCC 14579
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
4990018..4992633 [-1], 2616 bp
Product Function:  
lanthionine biosynthesis protein
Product Locus:  
 NP_834752.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosE in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:2616 bp
>BC5084|ThioFinder258 Bacillus cereus ATCC 14579
ATGAAACCAATAAACTATGTACCACATTTTTTATGTAGAATATCTGGTGAAGAAATAAACTCTATTTCAG
AAATTGAGTTTATTAAAACCTTGGAATGTTTAGAATTATCCGAAGGAATTTTAAGGAAAATAAATTCTTT
ATCAGCAGACTTAACGAAAGATTTACATGATTGTATTTCTTTATATAAAGAACAATCTATTTCACGTGTA
TTAATAAATCTTAAAAGAGATATTTTTAATATGAGGTTTAATCGAGTTCAAAAGTATAAACTAGAAAATA
TCTCAGGTTTTAACCACGATAAATTAAATTTATGGTTAAATTTAGCTCAAGAATATCAAAGCACGCTACA
TCTGATGAGAGAAACTTTTAAAATGGAAATACAGGAAAAAAGAGGGAAATTAAAGCAGTTATTTAGTAAT
AGTGAATATATAAAAGCCATTCAAGTCTCAAATACTCAACTTTATGAAAATCTCCTAGAATACTTACAAG
ATAATCAAAGTCATCCTCCAAAAAAGATGAGGAATATTGAACAGTCTCTAATTAATTACCTAAGTCGTAT
GATATTTAAGCCAACTCCCTTCAGTTCATTTACAGGATTAAATTACGGTTTTTTTAGTCAGGAAGATTCA
AGTTTTGAAATAAATACTAAGGAAAGCAAAGGTCACACTCGAATAAACATGGTTTATTTAAAAAAAATTG
AAAGAATGTTATTAAATCGAATATCTATAAAAAATAAATGTTATGTTTCGTTAAATCAAACGATAAACGA
AGAGGAAAATTATATGTTTTTTCGAAGAGGTAAAGATGGGACTAGTCAAGCTTTTACTGGTGAAGCTTTT
ATAAAGATAAAAAAGAGCGAGCTCTTAAAGGAGTTAATTCAATATTTTGAAGGAATATCTTCAATGAATA
TAGTTGAGGTTGTATCATTTCTTTCCGAAAAAACAAATTATGAAACTGAAGCTTTATATAATTACTTATT
TAAGTTAGAGAAAATGGGAGTGTTAGATTTTAGCTTAGGTGTGTCCGAACAATCGGACAATTACACGAAA
GATTTGATAGAAAACTTATTGGGGATTAAAGATTCATTAGTTGAAAAATCGGTCTCACACCTTGTAGAAA
TAGAAAAAATTCAGGCGATTTTCTCTGAATCCAATTACCAAAAACGTTATGTACTTTTAAAAAATTTACA
AGAACATATAAAGAAGATTTATAGTTTATTTGATTTAAAATTAGAGTCTAATGATTTGACCTCTCTATTA
TTCGAGGATGTTAGTTATAAAAATACTAAGATTATATTAAATGAAAATCAATGGAAAACGCATCTTGATG
ATTTTAATTTAATTAAGAATTTAATGCCACTTTTTGATGATAATATCCTTGAAAAATTAAGTATGAATAT
AATTTTTAAGGATATATATGGTAACAAGGGGGCAATAGATTTATTAGAATTCTATAGAGAGTTTAATAAA
TATGATAAAAATTTATTATGGAAGAAAATTAGAAAAAATGATACATATCTTTATTTAAAAAAATTGAGAA
CAGAGTTTTATGATTATCTAGAAACACAAATTAATATGGGGTTAGACACTATCTTTTTAAATAAAAGTTG
GTTAAAGAAATTTATTAACAAGTTCCCTGATTTATTGAAGAGTAAGGAAAATTATTCTTTCTATTTTCAA
ATAGCCTATGATAATCAAGATAATAGAATTTTAGTTTTAAATAAGATAGGGCCAGGATTAGGTAAGCACT
TTTCAAGATATGGTAATTTATTTTTAAATAGCGAATACAAGGAAAATAATAGATTTATTAATTCTCTTAT
AGAACAGTATAAAAAATATGATCAAAATGGGGGGGTTTTAACAGATTTAAATGCAGTGTTAGGTCTAAAT
CTTAATATGCATCCTAATCTTTTAAATTATGAAATTACTTATCCAGGATGCAATCCTAGTAAAGGAATTA
ATCAAGTAGCATTAAAGGATATTGAAGTATTGTATGATTCTAATTCTGACCAACTAAAATTATATTCTAA
ACAATATAGACAGAATGTTAAATTACTTCCATTGGGATTTTTGTTTCCAGCATTGTCCCCATCTTTATAT
AAGTTTTTATGTGGATTTTCGGAATCAAATGGGATAGAGTATTCTTTTTGGAACAAGTTCTTAAATGAAC
ACAATAATAATTTTTCACTTTTACCTAGAATTATGTTAGGATCAGTAGCTTTGGATAGAAGAACATGGAA
AATTAATGCGAAGGAAATACAAAAGGAATTTTCTAAAGATACATTTGAAACTTTTATTAACTTCCATAAG
TGGGTGAAAGAAAATCAACTACCGGAAGATATATTTTTAAGGGTTGCAAACACAATGGACGCTTTTAGTG
AGAATGAATTATTAAATCAAGATTTAGGAAGTTGGATTGCAGAAATTAAACAAACTAAACATCGTAAACC
TCAATATGTTAATTTTAATAATTACTTTCATATCGATGCCTTAAGAAAGATTATTAAAGATGTTAATAAT
ACAGTAACAATTCAAGAAGTTTATCCTCATCCAGATGATGTGTATTATCAAAAAAATAGTAAAAAATGTG
TAGAATTTTTAGTTGAGGTTTTTTAA
 Primer design

Protein Sequence:871 a.a.
>BC5084|ThioFinder258 Bacillus cereus ATCC 14579
MKPINYVPHFLCRISGEEINSISEIEFIKTLECLELSEGILRKINSLSADLTKDLHDCISLYKEQSISRV
LINLKRDIFNMRFNRVQKYKLENISGFNHDKLNLWLNLAQEYQSTLHLMRETFKMEIQEKRGKLKQLFSN
SEYIKAIQVSNTQLYENLLEYLQDNQSHPPKKMRNIEQSLINYLSRMIFKPTPFSSFTGLNYGFFSQEDS
SFEINTKESKGHTRINMVYLKKIERMLLNRISIKNKCYVSLNQTINEEENYMFFRRGKDGTSQAFTGEAF
IKIKKSELLKELIQYFEGISSMNIVEVVSFLSEKTNYETEALYNYLFKLEKMGVLDFSLGVSEQSDNYTK
DLIENLLGIKDSLVEKSVSHLVEIEKIQAIFSESNYQKRYVLLKNLQEHIKKIYSLFDLKLESNDLTSLL
FEDVSYKNTKIILNENQWKTHLDDFNLIKNLMPLFDDNILEKLSMNIIFKDIYGNKGAIDLLEFYREFNK
YDKNLLWKKIRKNDTYLYLKKLRTEFYDYLETQINMGLDTIFLNKSWLKKFINKFPDLLKSKENYSFYFQ
IAYDNQDNRILVLNKIGPGLGKHFSRYGNLFLNSEYKENNRFINSLIEQYKKYDQNGGVLTDLNAVLGLN
LNMHPNLLNYEITYPGCNPSKGINQVALKDIEVLYDSNSDQLKLYSKQYRQNVKLLPLGFLFPALSPSLY
KFLCGFSESNGIEYSFWNKFLNEHNNNFSLLPRIMLGSVALDRRTWKINAKEIQKEFSKDTFETFINFHK
WVKENQLPEDIFLRVANTMDAFSENELLNQDLGSWIAEIKQTKHRKPQYVNFNNYFHIDALRKIIKDVNN
TVTIQEVYPHPDDVYYQKNSKKCVEFLVEVF