Home 

Gene Symbol:  
BC5081
Organism:  
Bacillus cereus ATCC 14579
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
4986506..4988074 [-1], 1569 bp
Product Function:  
NADH oxidase
Product Locus:  
 NP_834749.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosF in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:1569 bp
>BC5081|ThioFinder255 Bacillus cereus ATCC 14579
ATGTTGAAGACTTACAAAGATATTGAAGATTTTTTATATAATTTGCAATATTCGCCTGCTAAAGCTTCAG
ATTTCAATTTAGATTTAAGTAATTATGATAGACCCTTGCCTTTTAAAATTTATAGGAATAGAGAATCGAT
AGATTTAGACGATAACTTTCCGATTTGTATTAATGATTTAGATGGTATTGATTATTCAAATTTCGAAATT
ATTAGTTATTTATTGTGGTATACCTATGGTTTTACCAGCTACAATTGGTTAACAAAACCAACATTAAATG
GTCAGAATACATCCTTAAGTTTTTTTAGAAGAAGTGTAGCCTCAGGTGGCGGCTTATATCCTGGGGAAAT
TTACTTATATGTGGAGAGTATTAAAGGTATCAAGTCAGGATTATATTATTTTGATGTTAGGGGACCGAGA
TTAATTTTACTAAGGGAAGGAAATTTTCAAGAATTTATCAAAAAATCTTTGCAATATAATCAAGATAGAA
ATGTTTATATTTTTATAACATCATTTTATTGGAAAAACTTCTTTAAATATTTAAATTTCTCGTATCGTTT
ACAAGGCTTAGATATCGGTGCTATTGTAAGCCAAGCTCACCTAATTTCAAAGAAATTAGGTCTTAATTCG
GAGATTAGGTATCACTTTGATGATAAAAAAATTAATGATTTTTTAGGAATCAACGCTGAGGAAGAAAGCA
GCTACGTAGTTTTGCCTATAGATATGGATAATAATTCATATAAAAGTGAAAATAAGGTTCCCGCTTTTGA
GTACTTTAAAAACGATACAACATTCAATTATATTGAACATTTAAATGTTGGCCCCAAAAATGTATGTCAG
GATATTTATAAAATCAATAGTAATATTATCAATAGTGGCTTAATTAAAGTTAAAAAAAATGAAATAGCAT
CTTTTAAAGAGGAGGCAAATGTTGTTCATAAAGAAAAATATGATTATGACATTTTGAAGGCTTCTGTAAG
TCGTATATCACCAGGAGAGAACTTTTTGTCTGATTTTTTGAATATTCAGCATGTTCACAAAGTTCTAGAT
GTTGGAATGCAGGAACAATTTAAAAATGATATTTTTAGCGATAATTATAGTGTTCTAAAGGATGTTGAAA
TTTACTTTTATGCCAATAAGATTGAAGGTTTACCAAAAGGCTACTATTACTATAATCCAAGTAATAAAAG
TTTCGTTTTGAAACATAAAGGTGATTTTTCTAGTGTTTTTCAGGAGAATCTTACACGAAAAAATTTTAAT
TTAGTAGAAATGCCTTTAATTGTGCACTTAGTATTAAACATGAAAAAATTTATAGAAAATATGAAATTTA
GAGGCTATAGAGTCATGCAAATGGAGGCAGGGAGAATTATGCATCAAATACAATTGAATGCTGCAGGTTT
GAACCTAGGGAGCCATCCAATGTTAGGTTATAGGGCTGATAATTTGGAGGAGTTTTTTGGTATTCAAAAT
AATATAACTGTCCAGATGTCTATTGGTAAATATAGACCTTTATTGAGGCTAACCAATAATTTATTGAATA
AAACTAAAGGAGAACAATTTTATGTATGA
 Primer design

Protein Sequence:522 a.a.
>BC5081|ThioFinder255 Bacillus cereus ATCC 14579
MLKTYKDIEDFLYNLQYSPAKASDFNLDLSNYDRPLPFKIYRNRESIDLDDNFPICINDLDGIDYSNFEI
ISYLLWYTYGFTSYNWLTKPTLNGQNTSLSFFRRSVASGGGLYPGEIYLYVESIKGIKSGLYYFDVRGPR
LILLREGNFQEFIKKSLQYNQDRNVYIFITSFYWKNFFKYLNFSYRLQGLDIGAIVSQAHLISKKLGLNS
EIRYHFDDKKINDFLGINAEEESSYVVLPIDMDNNSYKSENKVPAFEYFKNDTTFNYIEHLNVGPKNVCQ
DIYKINSNIINSGLIKVKKNEIASFKEEANVVHKEKYDYDILKASVSRISPGENFLSDFLNIQHVHKVLD
VGMQEQFKNDIFSDNYSVLKDVEIYFYANKIEGLPKGYYYYNPSNKSFVLKHKGDFSSVFQENLTRKNFN
LVEMPLIVHLVLNMKKFIENMKFRGYRVMQMEAGRIMHQIQLNAAGLNLGSHPMLGYRADNLEEFFGIQN
NITVQMSIGKYRPLLRLTNNLLNKTKGEQFYV