Home 

Gene Symbol:  
BC5085
Organism:  
Bacillus cereus ATCC 14579
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
4992661..4994304 [-1], 1644 bp
Product Function:  
putative cytoplasmic protein
Product Locus:  
 NP_834753.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosG in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:1644 bp
>BC5085|ThioFinder259 Bacillus cereus ATCC 14579
ATGACAAAAAAGGATCGTATTAATTTATTTGAATTGAAGAAATGTTTATCAGAAGGACATAATGTAAAAA
TATCTGGAGATTTATTGAATGCTTCAATGGTTGGATTAGCAATTACTTTAGCATTTAAACTAATAAATAA
TGAGGTTTCGGAATTTTCGTATATTATTGACAAAAAGACATTGAGATTCAATGGTCATAATTTTTTACCT
AATCCACATTGTCAAGTATGTGGGCACATGGATAATGACGAGAAAAGATTAATAGAACACAAATTTTTTA
CAGCACTTAACGATAATACTCTTAAAGAAAAGAAAGGAAATCGTTTTTTATCAAAAGAATATTTAGAAGA
TACCCTATCTAAAAATTTTTTAGATGTAGAAACTGGTATATTTAATAAACTTTTGGACGATTATGAAAGT
CCTTTCGCAGTTTCGGTAGCAAATCTTCCTTTAAAGGTTGGAAAGGATGAGGTTGGTGTTGGAAGAACGG
ATAATTATGCTAATAGTCACTTAACTGCAATATTAGAAGGAATAGAGAGATATTGCGGAATGGAACCAAG
GGGGAATAGAACTAACGTTTTTGGTAGTTATAATGAGCTAATGGAAAATGCTCTCAATCCATCTGTTTTA
GGATTACACGCGGAAGAACAGTATCAATTAAAAAGATTTCCTTTTAATAAATATAATCCAGATAAAAAAA
TGAAATGGGTCTGGGGGTATTCTTTTAATAAGAATAAGGCGATATTAGTCCCTGAAACTTATGCCTATTA
TGGTACGAATTATAGAGATGGCGTTCAAAATAGTTTTGTTTATGAAATCTCGAATGGATGTGCTTTAGGA
GGACATTTATTGGAAGCTACATTGCAAGGAATTTATGAAGTAGTGGAAAGAGATGCTTTTCTTATATCTT
GGTATACTAAATTACCATTAAAACGTATAAGAAAAGAATCTATTAAGGATCAGACGATTCAATTATTATT
AACGAGATTTGAATATCAAACTGATTATGATATTCATCTGTATAATATGACTTTAGAGAATAAAATACCA
ACTATTTTAGCTATTGCAAAAAATAGAGGTGCTTTTGGCATGAATATTTTATGTGCTGCAGGTTGTCATT
TAGATATAAATAAAGCAATTGAAAGTTCATTACATGAGTTATGTGGAATCTTAGAGGCAATCAAAAGTAA
ATTTGAAAATAGGAAAAGTGAATTATACGAAATGGCAAAGAATTATTCACTTGTACGGACGATGGAAGAT
CATTCATTATTATTTGGATTGAAAGAACTTGAAAAAGAGTTTGATTTTCTATTAAAGAGCCCGATTGAAA
TTGATTTAAGTGAGGTAGAACCTTTAAAATATAGCAACAATATACATACAGATTTATTGAATGTAATTGA
TTATTTTAAAAAAATAAATTTAGATATCATCGTAGTCGATCAAACCGCGGAAGATATAAAATTTAACAAC
TTGTATTGTGTAAAAGTTATTATTCCAGGAATGTTACCTATGACATTTGGACATGATATGAGAAGAATAC
ATAATTTACCAAGGATATTCCGTGTTCCAAGGGAATTAGGACATAAAATTAAGAATGAAAATGAAATTAA
GAACAATCAGGTAACTCCTCATCCTTTCCCATAA
 Primer design

Protein Sequence:547 a.a.
>BC5085|ThioFinder259 Bacillus cereus ATCC 14579
MTKKDRINLFELKKCLSEGHNVKISGDLLNASMVGLAITLAFKLINNEVSEFSYIIDKKTLRFNGHNFLP
NPHCQVCGHMDNDEKRLIEHKFFTALNDNTLKEKKGNRFLSKEYLEDTLSKNFLDVETGIFNKLLDDYES
PFAVSVANLPLKVGKDEVGVGRTDNYANSHLTAILEGIERYCGMEPRGNRTNVFGSYNELMENALNPSVL
GLHAEEQYQLKRFPFNKYNPDKKMKWVWGYSFNKNKAILVPETYAYYGTNYRDGVQNSFVYEISNGCALG
GHLLEATLQGIYEVVERDAFLISWYTKLPLKRIRKESIKDQTIQLLLTRFEYQTDYDIHLYNMTLENKIP
TILAIAKNRGAFGMNILCAAGCHLDINKAIESSLHELCGILEAIKSKFENRKSELYEMAKNYSLVRTMED
HSLLFGLKELEKEFDFLLKSPIEIDLSEVEPLKYSNNIHTDLLNVIDYFKKINLDIIVVDQTAEDIKFNN
LYCVKVIIPGMLPMTFGHDMRRIHNLPRIFRVPRELGHKIKNENEIKNNQVTPHPFP