Home 

Gene Symbol:  
BC5086
Organism:  
Bacillus cereus ATCC 14579
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
4994656..4996167 [-1], 1512 bp
Product Function:  
putative lantibiotic biosynthesis protein
Product Locus:  
 NP_834754.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosH in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:1512 bp
>BC5086|ThioFinder260 Bacillus cereus ATCC 14579
ATGGTAAATATACCTTTGAAAGATATAGTGAGTGAGTTAAGCAAAACCCAAGAAGAAAAATTTTTAAAAT
TAATTGCCATATTAGAGAAGAATGGTTTTGTAAAATATACCGAAAGGGTTATTGATGAAAATTATTATAA
AAATTATGAAAAAGAAATTGCATTTATAGATTATTATACTAATAATGGCATCGAATTATTTAAAAAACTC
TCTAATTTCAAGATTTGTTTATATGGTAGCAATAAGTTATCTAATACTATTCAAAAAAGCTTAGAAAACA
TAGGGATACAAAATATTAAAAGAGGCTCTCGTTTTGATTTTGAGGGAGACATTGTTATTTATTGCAATAA
TGATGTTAATGAAAGGGAAAATCTACTGGAATGTATGGACTTTTCTCAGAATAAAATATTTATTTTTGTA
GGTAATAAAGAATCATTAGGAATTATTAGTCCTATTATAAAAAATTTAGATGATTGGAAGGAATTTGAAA
ATATATTAGAGATTGGTGCAGATAATATTAAAGAAAATACAACATTTACTAGCAACTCTATATTAAGTAG
TATGCTAAGTTTTGAAATTATAAAGTATGTAACAAATTGTTTGCAAAGTGATTTAATTAATGCGGCATAC
ATTTTAAATACTGATACTTTAAAAGGGAATTTTGTTCAGGTAAAAAAAAAAATAGACTTAAAACAAGATT
TTATTGAAACTTTCAAACAATCAAGCGGAGGCAACGGTTTGTATATCAATAAAATAGGTAGAGGTTCTAG
GAAACAAATTCCGCTCTCGCAATGGGAGGTTGAATTGGATAAATTAGGTGACATGAATAGTGAAAAAATT
AAGGTCGTTAGCTTTGGTGATACCCACCAGGAAGCGAGGTTTAATACTTATTATAAAACCATAGAACATC
TAATAATCAATGGGGAATTTAACTTAGAGGAATCATATAGCTTTAAGAATCTTGATACAATCACTTTAGC
TATTGATGAACAATTTAAAAGAAAATTAACAATTTCATGCGACATAGATAAAGAACTTGCAATCAGAAAA
GCAATATTAAAAGCAATTTTAAAGAGGGAAATTAATGTAATTGATAATTATCAAGAGCTTTCCCCATTAA
AAATAAGTGATTATATAGATAATAAAAATATACAATACTATTGTAAACTGATTAACATTTTAAAAGCGAA
AATAGAATTGCGTTTTAAGAAATTAGTAGAGGGTTTGTTTTTGGTAGTAGTTAGTGACAATAGTTATAGG
GGAGTTAGTATAGGATTTAATTTAAATACAGCATTAGAAAATGCTCTTAGGCAATTTATTAATAATTTAC
AAAATAGTATCTATACAATAAATATTGAAGATGTAATATTTAAAAGAATTAATGATTGGGATGATGAATG
CATTCGAGAGTTTTTGACAGATGAAAAATTAGAAGTTTTTATCTGTAGTATACAAAATAATGTTATTTCA
GCAGAAATTTCTATAGTTGGAGCAATATTAATAGAAAGTTAG
 Primer design

Protein Sequence:503 a.a.
>BC5086|ThioFinder260 Bacillus cereus ATCC 14579
MVNIPLKDIVSELSKTQEEKFLKLIAILEKNGFVKYTERVIDENYYKNYEKEIAFIDYYTNNGIELFKKL
SNFKICLYGSNKLSNTIQKSLENIGIQNIKRGSRFDFEGDIVIYCNNDVNERENLLECMDFSQNKIFIFV
GNKESLGIISPIIKNLDDWKEFENILEIGADNIKENTTFTSNSILSSMLSFEIIKYVTNCLQSDLINAAY
ILNTDTLKGNFVQVKKKIDLKQDFIETFKQSSGGNGLYINKIGRGSRKQIPLSQWEVELDKLGDMNSEKI
KVVSFGDTHQEARFNTYYKTIEHLIINGEFNLEESYSFKNLDTITLAIDEQFKRKLTISCDIDKELAIRK
AILKAILKREINVIDNYQELSPLKISDYIDNKNIQYYCKLINILKAKIELRFKKLVEGLFLVVVSDNSYR
GVSIGFNLNTALENALRQFINNLQNSIYTINIEDVIFKRINDWDDECIREFLTDEKLEVFICSIQNNVIS
AEISIVGAILIES