Home 

Gene Symbol:  
BC5082
Organism:  
Bacillus cereus ATCC 14579
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
4988049..4989026 [-1], 978 bp
Product Function:  
hypothetical protein
Product Locus:  
 NP_834750.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosO in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:978 bp
>BC5082|ThioFinder256 Bacillus cereus ATCC 14579
ATGGAGCAGTATCATAAAATTGTATTAACTGGAAGTAATGCTGAGACTATGTTAATAAAAAATATAGAGC
CTGTAGCAGTTAAGTTTATAAATAACTATAAGGGTTTTTTCTATGTTTTTAAATATAGTAAAGATTTTCC
AATTATCGATGTTTATATCAACAACAAAATTGTTACAGAAAATCAATTAAATAAAATTTTACAGAATTCT
GGGGCTAAATATAAAATTTATAAAAATTCAATATTTAATGAGACACAAGGGAATTTTGGGATGTTAGGTG
ATAAATATCTGGCAGAATTTTTTAAAAAGACAAATGAAATTAGCCTTAATATACTAAATCAAAATTTTGA
GAGTTACAATAAAAAAATAGAATTTGCGCTAGAGATAATGTTAATTTCAGCGCACTATAATTATGATTCA
ATAAAAAAAGGCTACTTATCCTATGCATCTCATGTAAATGGATTTTTTACTAGATGGAAAGATCCAAATA
AAATTAGAGATATATTTCATAAGAACTACTTAAATAACAAAGAGTACCTAGAATCGAAAGTTTCAGAAAT
AATAGATAATAACAACAGAAGTAGCTTGAGCGAATTATCGGATATTATTACAGAAATGAAGAAAGAGATG
ACTACTGATATTGAGAAGGGGAACCTGCATGTATTTAATATTGAATTACTACAAAAACCAGGAGAAAGAG
ATTTTCTAGAAAAAAGTCAGTTTCATAAGACGATATTAAATAATCCAGATTTCTCTAATTTTATGAATAA
AGATATAAACTTTTTAGGTTCACGCCTAATAACTGTATTTACGTACTTATTAATACGAAATTTAGGGATT
CAAAATAAAGATAGATATCTACTTTGCTACTATATCTATAAAATTATTGAAGAAAAATATAATATAGATA
CTTTGGAATTAATAAGGGATTTTGGTAAAGGGAGGGATAATAATGTTGAAGACTTACAAAGATATTGA
 Primer design

Protein Sequence:325 a.a.
>BC5082|ThioFinder256 Bacillus cereus ATCC 14579
MEQYHKIVLTGSNAETMLIKNIEPVAVKFINNYKGFFYVFKYSKDFPIIDVYINNKIVTENQLNKILQNS
GAKYKIYKNSIFNETQGNFGMLGDKYLAEFFKKTNEISLNILNQNFESYNKKIEFALEIMLISAHYNYDS
IKKGYLSYASHVNGFFTRWKDPNKIRDIFHKNYLNNKEYLESKVSEIIDNNNRSSLSELSDIITEMKKEM
TTDIEKGNLHVFNIELLQKPGERDFLEKSQFHKTILNNPDFSNFMNKDINFLGSRLITVFTYLLIRNLGI
QNKDRYLLCYYIYKIIEEKYNIDTLELIRDFGKGRDNNVEDLQRY