Home 

Gene Symbol:  
PPA0860
Organism:  
Propionibacterium acnes KPA171202
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
938791..939744 [1], 954 bp
Product Function:  
putative lanthionine biosynthesis protein
Product Locus:  
 YP_055573.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosD in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:954 bp
>PPA0860|ThioFinder279 Propionibacterium acnes KPA171202
TTGAACTGTGTGCCGAGTGACAGCGCAAGCATGTCTGATCCTGGCGGCTGGCGGGCGCTCCATATTCACT
TGCCTCCCTCGGTGCAGTCCGAGTACCTAGCTGACGTGATTCTTCCCTCGATGTCAGCCTTGATGCCAGA
ACATGACTACTTCTTCCTCCGATATTGGCAGGGGGGATCACATCTCCGGCTTCGGCTCCGTAGCACTCCC
GAGCGCCCCCTAGATGATGAGGCTATCAACGAGGTTGCATGCCATCTCCGTAGCCTTCTCCCGGCGTTGT
CAGACCAAAAGCGCGCGGAGTACCGCTATTCGCAATCGCTTCAGGATCAGTTAGCCGAAATGGAAAGGGC
TGATTGCCTTCCCCTAGAGGCGGTTGGGACCGTGGTAGAGCGCCGGTACCAGCCTGAATATAGAAAGTAT
GGCGGATCGGTCGGAGTATCCATTGCAGAGGATGTTTTCTGTAGTACTAGCCGATCTGTCCTTCGCATTC
TAAGTGAGCGACCAACTAGCCACCGACAGCCCTTGGGGTATGCTTGCCAAGTTTTCATCCAGATGCTGGG
CTGCTTAGGGCTCGCAACTTCGCAGGTTGACCAGTTCCTCACCAGATATGCGCAGTGGTGGACCCCTTAC
TCAATGGCCGCTCGCCCTGAGATCTTAGCGGCGCGTCTCTACGCCAACTTGTCAAGCGTGGTGGCGGACC
TATGGGCCGCAAGTGAGCCCAACGGAATGTTCTCGGTTCCGGCTCTCAATGCTTATACCCAATGGTCACG
GCGACGGTCGTCCGCGAGAAATACCAGCGTAAAGATAGACCCAATGTTTCTATCTTGCTTAGCGAACTAC
ATTCACACAACCAATAACCGACTTGGGCTCCCACCCGCCCTAGAATCGACAGCGGCATATCTTGTCCAAC
TTGGATTCCGATCGGTGGCTGTCAGGGGGGAGAAAGTGCGATGA
 Primer design

Protein Sequence:317 a.a.
>PPA0860|ThioFinder279 Propionibacterium acnes KPA171202
MNCVPSDSASMSDPGGWRALHIHLPPSVQSEYLADVILPSMSALMPEHDYFFLRYWQGGSHLRLRLRSTP
ERPLDDEAINEVACHLRSLLPALSDQKRAEYRYSQSLQDQLAEMERADCLPLEAVGTVVERRYQPEYRKY
GGSVGVSIAEDVFCSTSRSVLRILSERPTSHRQPLGYACQVFIQMLGCLGLATSQVDQFLTRYAQWWTPY
SMAARPEILAARLYANLSSVVADLWAASEPNGMFSVPALNAYTQWSRRRSSARNTSVKIDPMFLSCLANY
IHTTNNRLGLPPALESTAAYLVQLGFRSVAVRGEKVR