Home 

Gene Symbol:  
PPA0859
Organism:  
Propionibacterium acnes KPA171202
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
936198..938810 [1], 2613 bp
Product Function:  
putative lanthionine biosynthesis protein
Product Locus:  
 YP_055572.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosE in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:2613 bp
>PPA0859|ThioFinder278 Propionibacterium acnes KPA171202
GTGCATCTCAGTCCATATGTAGTCTTTCGCAGGACACGACTCGCCTACTCTCAACTTCAGAGCAGCTCCT
TCGACGCACTCTGGCAGCAAGTGCAAGAAATGGTCGATAAGCATGCGCAATTAGAGGTTCAGACCAGCAG
GCTTACGGCACACCTGGAGTCTGTTATTTCAGTAACTGCGCCTCGTGACAGATCTCGACTAATCACATTA
AAACGTGACGTGCATAACATGCGCGTGGAAAAAGTGAAGCAAAGACTACTGCACTGTCAGGGCTGCACGG
CTAGCAACATTATGGAGCCTGTATCTAGTTGGATCGATACATGTCGATCATACGAAATACTTGAGCGTCG
GTTGAGTCAAGTATATGCGGACAGCCGAGACGAAGTGTCTCGTCACTACAGGTCCCTCTACCAGGCTGAC
GCAATAGAGCCAAGCATTCAACTCTCAGGTGGCCAGCTCCACAGTGACCTGACGCGTCTGATTAGCCACG
GTTCTAGGATAAAACCCACTAAAGAGCGGACTCTGGAAACGACTCTTGTAAACTATCTCTACAGGGCAGC
AACAAAGCCATCACCTTTCGGTCGTTTCGTGGAAGTAGGGGCCTTCGACCCGTCTCAACCAAATTCCGAA
CCTCGACGCTGCAGTGAATCCAGCGTGACGACAAACCGGATTCTTACCAGCTGGCTCACTGCAGTAACAG
CGCGTTCTTTCGCCGCACCAGAAATGCTTGCTATCCTCAACAGCACCCTGCGCGTTAAACGCGATATAAT
CCAGTTCATTGGAATTCCACCTGGGGAGTGGCGAGGTGCACCGAGCATTCCCGAGGAGCGCCTGCTAACT
ATCCGCAAGCGCGAAGATATGATGTCTGTTCTTAAGCTCCTAATGGGCGGCCCAAGATCAGTCGGTGACC
TCATTATTGCCCTTAATGACCAAGGCATAGATGAATCACACGCAACTAATCTTCTCAGCAGTTTGAGTAC
AGCAGGGATAATCTTCTTTCGGCTCCCAGTAGATGACCATGACGTACACTATGTACAGACTGCGTGTACA
GCGCTAAGGTTAACCAAAGATGAGTCACTTCGTGCCGCTTTCCAAAGTCTGGCGAACGCTGAAAAGGAGT
TCCCCACAGCGTCAGTCGCCACGCGTCACGACCTTCTCCTCAGCATCAAGGATTCCGTGAATACTGTCGC
GTCGGCACATGATGTGCCGGCCCCACCGGACAGCGTACTCAAGAGCCCTTTGTATGAGGACCTCCCCGCC
ACCGCGGCACCCCAGACATGGGATTCGAACACGGTTGAGAGATCAGCCCGCGCACTCAGGAGCATCTGGC
TACTGGGCGATTTAATGGATAGCTCTCAACGCCGACAGTTGGGCCTCTCCCAGTTCATAGCAGACATGAA
TAATGGCGCGCCAGTTACTTTTCTGGATTTCTTCGACTCGTTTTCGCGCCTTAGCATTCGTGAGCGCCAA
GGAATCCTGCGCGGAGAAAACTCACCGCAAATCGCCCGTTTCGCTCAGCAATATAGTGAAGCATTGCTTA
AAATTCGCGATGCCGTTAACTACACGCAGGACGAAGCCCACCTTGAATCTCAGGTAATTCTCGATGCGAT
CACCAATATTGATGATTTCCGACCGACTAAGTCGGTCACAATTCGAGGACAATTCACAACATCGCTCACC
TCCCATATAAGCCAACTGATAATCAACGGTGTTATGACGGGATACGGTACATACATGTCCCGATTCGCAA
CATTTGTAAACCCATCAGGTACTTGGAGTCTAGTCGACGGGATTCGGAGACATCTATCCGATCATTTTCC
AGGTCAATGTGATTTGAATTCCGTACTGGGATTCAACTTCAATGTTCATCCGCAAATGACAGCACATAGT
ATCGCCTATCCTGGAGTAGTTCCTGTGCTTAATGGTGCCAAGACACATTCGATTCAGGATTTAATACTGA
TTCCAACTGCTGAAGCAGGTCCGCGCCGCGTCGCTATCTTTGATAGAGCAGAGAACGAACTTATCGACCT
CCAGCCCATGAATTTCATGGTTCCTTTTGGGGTGCCTTTGCTGTATCGGACTCTAGAGTTCCTGTGCCCA
TCGACCAGATACCTATGGAACCCAGCTCAAGACCTTCTGGATATCCCAATGATAGAGAACAGTTGCCCTC
GGATTTACTTTGACGACGTAGTGGCTCAACGCCGTTCCTGGACGTGCAGCGCCGAGACGCTCCCGTGTCC
CCCAGAGAAACTCTTTAGGGGTGATCTTGCTGCTTTGCAAGCCTTCGACTCGTGGAGACTATCAGCGAGG
GTACCCAGACATGTCTTTGCCCTAGTACAAACGGCTACGGAAAGACAAATTTTTTCCGGAGCGGCCGACG
CGCCAACCTTGCTCTCCGAATACAAGCATCTTCGGAGAGCAAGTGTGCATAAGCCAATCTACCTGGATCT
ACGAAACCCACTTCTAGTCCGTTCTCTCGCGAAGGTGATCATGTCCAGGCCCGAACTATATGTCACGTTT
TCCGAGTTCCTCCCATCGGAGGCCGATTACACGCAGAACGGAAGCTGCCCCAGTTACGCAGAGGAGTACT
TCATTGAACTGTGTGCCGAGTGA
 Primer design

Protein Sequence:870 a.a.
>PPA0859|ThioFinder278 Propionibacterium acnes KPA171202
MHLSPYVVFRRTRLAYSQLQSSSFDALWQQVQEMVDKHAQLEVQTSRLTAHLESVISVTAPRDRSRLITL
KRDVHNMRVEKVKQRLLHCQGCTASNIMEPVSSWIDTCRSYEILERRLSQVYADSRDEVSRHYRSLYQAD
AIEPSIQLSGGQLHSDLTRLISHGSRIKPTKERTLETTLVNYLYRAATKPSPFGRFVEVGAFDPSQPNSE
PRRCSESSVTTNRILTSWLTAVTARSFAAPEMLAILNSTLRVKRDIIQFIGIPPGEWRGAPSIPEERLLT
IRKREDMMSVLKLLMGGPRSVGDLIIALNDQGIDESHATNLLSSLSTAGIIFFRLPVDDHDVHYVQTACT
ALRLTKDESLRAAFQSLANAEKEFPTASVATRHDLLLSIKDSVNTVASAHDVPAPPDSVLKSPLYEDLPA
TAAPQTWDSNTVERSARALRSIWLLGDLMDSSQRRQLGLSQFIADMNNGAPVTFLDFFDSFSRLSIRERQ
GILRGENSPQIARFAQQYSEALLKIRDAVNYTQDEAHLESQVILDAITNIDDFRPTKSVTIRGQFTTSLT
SHISQLIINGVMTGYGTYMSRFATFVNPSGTWSLVDGIRRHLSDHFPGQCDLNSVLGFNFNVHPQMTAHS
IAYPGVVPVLNGAKTHSIQDLILIPTAEAGPRRVAIFDRAENELIDLQPMNFMVPFGVPLLYRTLEFLCP
STRYLWNPAQDLLDIPMIENSCPRIYFDDVVAQRRSWTCSAETLPCPPEKLFRGDLAALQAFDSWRLSAR
VPRHVFALVQTATERQIFSGAADAPTLLSEYKHLRRASVHKPIYLDLRNPLLVRSLAKVIMSRPELYVTF
SEFLPSEADYTQNGSCPSYAEEYFIELCAE