Home 

Gene Symbol:  
PPA0864
Organism:  
Propionibacterium acnes KPA171202
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
942787..944355 [1], 1569 bp
Product Function:  
hypothetical protein
Product Locus:  
 YP_055577.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosF in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:1569 bp
>PPA0864|ThioFinder283 Propionibacterium acnes KPA171202
GTGGGAAATGCAGCTCGCTTTGACAAGCAGTTCAGGGTCCCTCGTCGGCCGAGCAGGCGGCTCGGTGTCG
ATATTGAGATCCGTGAGGATGCAACAATTCTTTGGGGATCAGATCGTCTGCAGACATTTACAGGAGGAAT
GAAACCTTCACTGATTGAGGATATTTTACGAGCGTGCGACGGAACTAAGACGGCACGTGAGCTCGCCTCT
GTATGTGATGTTACGGAGCCCTTGATGGACAAGATAGTGGCCCTTCTCTGGGTCTCGGGTGCTATTGAGG
AGGCGGGCCCGACCGATGTTGAAAGTTCTCCGCTTGGGGTCCTTTTGTCTCGCCTTGGGAACGCAACTGG
GGCGAATGCTAGCTGGCAGGAAGCTCAGCACAGAATTAACAGCATGCCGATCTGTGTTATGCCCCATTCG
GAACTTGGAACGGAGGTTGCGGGCGCGCTTGCTGGCACCTTTGAGGTTATCAATGAAGAGGCAGCTTTTG
AACGCGGCGTGGTTCTATTCATCTTTATCGAAACCGCGTCGTCTAAGATCGAACAGCATCACAAATTTGA
TGAACTGACAAAGAGAAGAGTGCTATTGGTTAGCGCTGCGGGTGACGAAGTTGTAGTGGGGCCGCTTTAT
GACCAGGCTATAACGCCCTGCCTTCGGTGCTGTTCGTCATCGAGGATCAAGCTGGATCGGGGTGCCTCGA
GCCCGGCGCAGCTTCGTCTCATGGCTGGAATTGTCTCGCATCATATTGTTGCGTTGGTAAGCAGGGCGTT
ACTCTCACCGCTGCCCACGGATTCCTTGGCGCTGAATGTGGTCACTGGTGTCCAGCGCTACTCTCCCCCG
GTGTCCAGACCGGGTTGCCCCGAATGTTCGCATGCGATCCCAGCTATTGCTAGTGAGCCGACGGTCGGTG
CCGTGTACGAGGCTTCCGTAGCACTCCCTCCGCGAGAATTCGTGAATGTAAGGGACTATCAAGCCCACTT
CTTGAGCGCAAATCAACAACTTCAAACGAAATTTAAGTCATGGGGAAAAAGGGAAAAATTCCCTTTGCCT
GACATTAATATTTCAGACCTACATATACAGATTGACGACCTTCTTTTTTTAGCTGCTGCCCTTAGGTTTG
GGTTCGGAATAGACCCGGAGCGGACCACTTCAAAAATAGCGAAGCGCTGGACGGCCTCTGGTGGAAACAT
TGGCTCGGTAAACGCATTCGTGAGCCTTCCTGCGATGGTAGGGCACATTCCCAGTGGGATTTATGGATAT
TCAGTTAGCGATCATTCCCTAGCCAAAGTTAGTCAGGAGTTGATTTCGGCGACTGACATCATGATCGCGG
CTTCTGCCGACCTACGGAAGATCGCTTCTAAATATGGGACATTCGGCTTGAGGATCGCGATTATGGACGC
CGGGTGTGCCCTTTCAACGGTGCGTCGTGTCTGCCGGGAAGTAGGCCGTACATTTTCGATGTGGAGCGCT
GACCTCGACGCTGGGTCTATTAGCGAGATGCTGCATCTTTCAAGTGCGCGTGAGCCTATTATTGGAGTTT
CAGTGCTGGGAAAGGGGCAACGAGGGTGA
 Primer design

Protein Sequence:522 a.a.
>PPA0864|ThioFinder283 Propionibacterium acnes KPA171202
MGNAARFDKQFRVPRRPSRRLGVDIEIREDATILWGSDRLQTFTGGMKPSLIEDILRACDGTKTARELAS
VCDVTEPLMDKIVALLWVSGAIEEAGPTDVESSPLGVLLSRLGNATGANASWQEAQHRINSMPICVMPHS
ELGTEVAGALAGTFEVINEEAAFERGVVLFIFIETASSKIEQHHKFDELTKRRVLLVSAAGDEVVVGPLY
DQAITPCLRCCSSSRIKLDRGASSPAQLRLMAGIVSHHIVALVSRALLSPLPTDSLALNVVTGVQRYSPP
VSRPGCPECSHAIPAIASEPTVGAVYEASVALPPREFVNVRDYQAHFLSANQQLQTKFKSWGKREKFPLP
DINISDLHIQIDDLLFLAAALRFGFGIDPERTTSKIAKRWTASGGNIGSVNAFVSLPAMVGHIPSGIYGY
SVSDHSLAKVSQELISATDIMIAASADLRKIASKYGTFGLRIAIMDAGCALSTVRRVCREVGRTFSMWSA
DLDAGSISEMLHLSSAREPIIGVSVLGKGQRG