Home 

Gene Symbol:  
PPA0862
Organism:  
Propionibacterium acnes KPA171202
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
940823..942142 [1], 1320 bp
Product Function:  
hypothetical protein
Product Locus:  
 YP_055575.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosG in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:1320 bp
>PPA0862|ThioFinder281 Propionibacterium acnes KPA171202
ATGACAGTTGAGCGTCAGCCTCTGCGGGAGCGTGCAAGGAGCCTCGTTTCACCATACGGACTAGTTTCCC
AAGTACACCCTCTGCACGCCAATGAAGCAGATCCACCGTTTCATGTGCATTTGGGTCGAACAGGCCACTC
AATACACGAGGGGCAAATTACTTTTGAGGGAGATATCGGAAACACCGACGGGGCAGGGTCGGGATCCGAC
AGTACCACGGCAGAATTTATTGCAGTAATGGAGTCCTTAGAGCGCTACTCCAGCGCAATGTGGGACGCTC
GTTCCTTTTTGCTGGAATCGGAAAATAATCTGCAGGAGCGACTTGTATCTCCCAACCAATTCCCACGCTG
TTCTACAGCCGAGCTAGATTCTGGACATGTACTCAGGCGGTACGACCCGGGCGTCCCAATACGATGGGTC
AGAGGATGGTCACTGACTTCAGGTCATCAGGTGTGGGTTCCGGCGATCGCGGTTTATCTGCATCTGCCGT
ACTTAAACGACTCTGAACGATTCATACGTTCAGTCTCGACCGGATGTGCGGTTCATGAATCCATGCGGAA
GGCTGTTCTTAACGGTCTTTTAGAAGTCGTCGAGCGAGATGCTATTGCTTTGACTTGGTTGCATGAGTTG
CCCTTGCCCAGAATCGCGGCTAGCGAGGCCGGTGAGTTCCCGCCGGAAGCGCTAGCCAGTTGGAAGTCAT
ATAGGGATTACGGAATCGAGACCCATCTCTTTGACGCAACGACGGATTTTGGGATTCCGGTGATCTTTGC
GCTCCAGATATCGGATCAGGATGACGACATCGCTCAGCTCGTAGGCGCTGCATCCGCTTTGGAACCCGCT
GAGGCGCTGACTAAAGTATTCAGGGAAATGGCATCGATCCGAATAGCACTACGCGCCTTTCTCGCCCAGT
CCACATCGATTAAGATTTACCCCGATGTGGCTAACGTGACAGGGGGTGCCGCCCTCATGGGCCAGCGCGC
GTACCGAGATGCATTTTCCTTCCTCCTTAACAGCGAGCGCGAAACGTCACCGTCGCGGATGCCTAACCTC
CTAGAGCTGAATGATGATCCACTGCGCGAGATGATTATTCGAATACGCCTGGCTGGCGCTGAAGTTATCG
CCGTCGATATCACGACGGACAAAGCGAGGTCAGTTGGTGCAAGAGTAGTGAAGGTTTTGGTCCCAGAGGC
GGTTCCACTCTCCTTTGTTCACCGAGAGAGGTATTTAGATACTCCTCGGCTCATATCCGCGCCTAATAGC
ATGGGATATTTGGTTGACACAGCGCCTACGTTCAACCGGAACATTCAACCTTTTGCGTGA
 Primer design

Protein Sequence:439 a.a.
>PPA0862|ThioFinder281 Propionibacterium acnes KPA171202
MTVERQPLRERARSLVSPYGLVSQVHPLHANEADPPFHVHLGRTGHSIHEGQITFEGDIGNTDGAGSGSD
STTAEFIAVMESLERYSSAMWDARSFLLESENNLQERLVSPNQFPRCSTAELDSGHVLRRYDPGVPIRWV
RGWSLTSGHQVWVPAIAVYLHLPYLNDSERFIRSVSTGCAVHESMRKAVLNGLLEVVERDAIALTWLHEL
PLPRIAASEAGEFPPEALASWKSYRDYGIETHLFDATTDFGIPVIFALQISDQDDDIAQLVGAASALEPA
EALTKVFREMASIRIALRAFLAQSTSIKIYPDVANVTGGAALMGQRAYRDAFSFLLNSERETSPSRMPNL
LELNDDPLREMIIRIRLAGAEVIAVDITTDKARSVGARVVKVLVPEAVPLSFVHRERYLDTPRLISAPNS
MGYLVDTAPTFNRNIQPFA