Home 

Gene Symbol:  
PPA0861
Organism:  
Propionibacterium acnes KPA171202
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
939741..940823 [1], 1083 bp
Product Function:  
hypothetical protein
Product Locus:  
 YP_055574.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosO in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:1083 bp
>PPA0861|ThioFinder280 Propionibacterium acnes KPA171202
ATGAATCCAAAAAACTCCAAAGTGACGGAACTTTGGTTTCCAGATAATTCAGACTCGCCATGTACTCTTC
TTCTCGACTTATCTCGGGCCTCCGCTGAGGGCACTGAGCCTAGTCCTCAATACTACTGTCGAACTTGGGA
CCCAACAACAAAAGATCCCGGAGTAAGGGTTGGCATACTTGATCCCAACCGCTTAACTCATCAAACGGCT
TTCCTTGGCGGTTCCGGTATTACGCATCACTTCTTGGTAATGGAAAAACCACCCAGCTGGCCTCTTCTAT
GGAACGCGGGTTTCGCGGGCTTGAAGCTTTCCACGATAAGCAAACAATTGTTCACCGCGTCATATCCATG
GATGGTAAAGTGGGCGCTACAGGCATCGGCTTGGACGGACGACGAACGCCTTCTGGCTCTTACGAAACTT
CTAGTTGCCCACGCTGATGCAAGCCTTCCACCGGTCGATAAGACTGAAATGCTCGGCCGCCTCCCTTTGA
AGTTGAGCTTGCGACTGATCACATATCGTTCCCACTACGAAAGCATCCGCGCTCGCACGATTGACCCGAA
AGCGATGGATACTGCGGTTAATCGGGCCTTCATGAAGTATCAAGACGAGCTCCTGCGATGGTCCCAGTCG
TTGACATGCTCGTCGAGCTATCGTGAGAAAGAATGGAGTAATCCCAACCTTTCAGAATGGAGCGCCATCA
TTTATTGCCATCTCCCACAAATTAGGCAACTCCTCAGCGGGGGAGGATTAACTGTCGCGGGCCCGACACG
CGAGGATATAGAAGCCTCCTTAGGTCACAGTATTCCTGATACACGATTTCACGAGCGTCTTGACCCCGCC
ATGCAGTATTATCTCAATCATGACCAAGACTTCACGGCATACAGATTCTGCACGGGTTTTTTGTACAGCA
ACCTGTACTCGCTAGGAATACCGTTGAGGCTGCGCTACCTTGTCTGTGGGTTGGCAGCACGTTTCAACGA
GGAGCTGTCGGACACGACTTGGCGCGATTTACGGGATCTCTTCCACGAGGCTGCTACTGTTGCATATTAC
ACACGCGACACAGACGGGAGCGGGATTAGATAA
 Primer design

Protein Sequence:360 a.a.
>PPA0861|ThioFinder280 Propionibacterium acnes KPA171202
MNPKNSKVTELWFPDNSDSPCTLLLDLSRASAEGTEPSPQYYCRTWDPTTKDPGVRVGILDPNRLTHQTA
FLGGSGITHHFLVMEKPPSWPLLWNAGFAGLKLSTISKQLFTASYPWMVKWALQASAWTDDERLLALTKL
LVAHADASLPPVDKTEMLGRLPLKLSLRLITYRSHYESIRARTIDPKAMDTAVNRAFMKYQDELLRWSQS
LTCSSSYREKEWSNPNLSEWSAIIYCHLPQIRQLLSGGGLTVAGPTREDIEASLGHSIPDTRFHERLDPA
MQYYLNHDQDFTAYRFCTGFLYSNLYSLGIPLRLRYLVCGLAARFNEELSDTTWRDLRDLFHEAATVAYY
TRDTDGSGIR