Home 

Gene Symbol:  
Caci_4204
Organism:  
Catenulispora acidiphila DSM 44928
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
4762543..4763664 [-1], 1122 bp
Product Function:  
lantibiotic biosynthesis protein
Product Locus:  
 YP_003114909.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosD in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:1122 bp
>Caci_4204|ThioFinder300 Catenulispora acidiphila DSM 44928
ATGACCACGCTCGCCGCCGAGCCGGCGACCGCCCCGGACGCGCCGTCCGAACCCGGGCCGTGGCAGGCCG
TCCACATCTTCTACGGCGCGGTCCGGCTGTCCATGCTCACCGAGTCCATCAGGCCTCTGATCGCCGGACT
GCGCCAGGACGGCTTGCTCTCCAGCTGGTTCTTCATCAACTACTGGGTCGAGGGCACGCATCTGCGGCTG
CGCCTGCAGCCGTCGTCGGAAGCCGCGACCGAGACGGTCCTGGAGCGTGCCGAAGCAGCGATCGACGCGT
ACCTGCGAAGGCGGCCCGCGTTGTATTCGGCCGACCCGGACTTCCTGTCCGACGTCTACACCAAGATGTT
CGACTTCGAGTTCACCGACGAGCAGCGCGCGGTCTACCTCGACGAGAACGGCCGGATGCGGTTGCGGGAG
AACAACACCCACAGCCGTGAGCCGTACGAGCCAGAGTACGGCAAGTACGGCGGCGCGGCCGGGGTCGCGG
TGGCCGAGTGGCATTTCGAGCACTCCTCGGACCTGGTCGTGGACCTGCTGCGGACGATGAACACGCACCT
GCGCTCCATCCGGCTGGGCATCGCCGCACAGCTGATGATGGTGACGGCGGCGGCGTTCGAAGCCGATGCC
GCAACGTGCGCCGACTTCTTCGAGGGCTACCACGGCTTCTGGCGCCGTGCCTTCGACACCGACGGCGACG
TGACCGACGAGGACTACGACAGCGCCTACGACAAGACCGGTCCCGGGATCAGCCAGCGGTTCGCCGCGGT
GCGCGAGGCGTTCGCGCGCGGCGCCGCCGGGAGTCTGCCCGGCGTGCTGGGCGCCTGGGCCGAGCACTGC
ATCGAGGTGCGGGCACGGATCGGCGCGCTGGCCGAGGCGGGCGCGCTGGTGTTCGAGTCCTGGGACGGCT
CCGACAACCAGGTGATCACCGACGCGGGCGCGGCGGCGCGGCGTCTGCTGCTGCCGTACCTGCACATGAC
GAACAACCGGCTCGGCATGACGCTCACCGACGAGGCGTTCCTCGGCCGGATCCTGGCCCGCGCGCTGCGC
GAGGCGGAGCACGCTGCCCCGGAGTCGGAGTCGGAGTCGGAGTCGGAGTCAGAGCCGGAGGCCGCGTCAT
GA
 Primer design

Protein Sequence:373 a.a.
>Caci_4204|ThioFinder300 Catenulispora acidiphila DSM 44928
MTTLAAEPATAPDAPSEPGPWQAVHIFYGAVRLSMLTESIRPLIAGLRQDGLLSSWFFINYWVEGTHLRL
RLQPSSEAATETVLERAEAAIDAYLRRRPALYSADPDFLSDVYTKMFDFEFTDEQRAVYLDENGRMRLRE
NNTHSREPYEPEYGKYGGAAGVAVAEWHFEHSSDLVVDLLRTMNTHLRSIRLGIAAQLMMVTAAAFEADA
ATCADFFEGYHGFWRRAFDTDGDVTDEDYDSAYDKTGPGISQRFAAVREAFARGAAGSLPGVLGAWAEHC
IEVRARIGALAEAGALVFESWDGSDNQVITDAGAAARRLLLPYLHMTNNRLGMTLTDEAFLGRILARALR
EAEHAAPESESESESESEPEAAS