Home 

Gene Symbol:  
Caci_4206
Organism:  
Catenulispora acidiphila DSM 44928
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
4766487..4768082 [-1], 1596 bp
Product Function:  
nitroreductase
Product Locus:  
 YP_003114911.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosF in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:1596 bp
>Caci_4206|ThioFinder302 Catenulispora acidiphila DSM 44928
ATGGGCACCGCCCACGACTATCTGCGCACGGTGATGAACCGGGCCCGGGTGCCGATGGAGCCGATCGGCT
TGGAACCGGACTGGGGCGACAAGCCCCGGCATCTGAAGTACTACCCGGACGCCGAACGGCTGCCGCTGCC
GATGGAATCGGTGCCGACGCCCGATCCGGCTGGCGACCAGTCCGGCAACCAGCGCGGCGACCAGCCCGGC
GGCTTCTCGGTCCCGCTGCTGGCGGACATGCTCCGTCACTCCTACGGCTACCTCGGGCGCCGTCTGGCTC
CGCACGCCAACAACGACCTGGTCACGCTGCCGGACTACGCCGACGCCAACTGGTGGCGCGGTACCGCTTC
CGGCGGCGGCTTGTATCCGGTGAGCGTTTATTGGGCTTCCGGCGCGCGCGGCCCGGTGCTGCCCGGGCTC
TACCACTACTCGCCGCCGCATCACGAGATGCGCCGGCTGCTCACCGGCGATGTGACGGCTGAGATCCGTG
CCGCGTTGGGAGACGCACCGCAGTCCGTGCCCACCGACACCGACCAGTTCCTGGTGCTCGGTCTGAAGTT
CTGGCAGAACGCCTTCAAGTACCAGAACTTCTGCTACCACGCCGTCACGATGGACGTCGGGACGATTCTG
CAGAGCTGGCAGATGTTCCTGGCGGACCATGGTCTGCACCTGACCCCGGCGTTCTGGTTCGACGACCGGC
GCCTCGGGGACCTGCTCGGGGTACCGCCGGAGCAGGAGGGCGTCTTCGCGGTCGTGCCGCTGCCCTGGAC
CGGGCCAGTGGTAAAGACAGGCGAGAATCCCGAGTACCCGCCTCGAGTCCGTCTCAGCGAGCAGGAGCGG
TCACGCCGCGTGCGCACCTTCGACCTGAACATCGCGGTCCATCAGGCCACGATGACGCCCGCGCCCCGGC
CCGAACCGCCGGCGCTGGATCCGGCTGCCGCGCACCGGCCGCCGGAGGACCGTCCGGTCGTGGACCTGCC
CGAACCCCTGCCGCCGGCGCCGGCCCGGCAGGCGTTCCGGGCACGCCGCAGCAGTTTCGGCCGGTTCAGC
GGCGCGGTCCCGACCACCGGCGCCGAGCTGGCCGCGATCCTGGCGGCCGCCTCGCAAGCCGCCGCGTTCG
CGTGCGACGTCGCCGAACCGGAGCGCGGGCTGGAGCTGGCCAAGTTCTACGTCTTCGTCAACCACGTCCG
TGGTGTCGCGCCGGCTGCCTATGAGTACGACCCCGCCGCGAACCGCCTGCTGCGCGTGACGGACAGATCG
CCTGCGGACTTCCTGCAGCCGACGTACTTCCTGGAGAACTACAACCTCGAAGAGGCCGGTGCGGTGATCG
TGCCGTCCGTGCGCGCCGACGCGCTGTACGACAGCGTCGGCGACCGCGGGTACCGCCTCGTGAACGCCGT
GGTCGGCGCGATCGCGCAGGCGGTCTACCTGGCCTCGGCCGGGCTCGGGCTCGGCTGCGGCGCGGCGCTG
GGCTTCGACAACCCCGCCTACGTCGAGGAGCTAGGGCTCGAGGGCACCGACGAGGCGCCGCTGCTGATCC
TCATGGTCGGCCGGGAGCGCGAGCGGCCTGCCGACTTCCGCTACGAGATCGGCTGA
 Primer design

Protein Sequence:531 a.a.
>Caci_4206|ThioFinder302 Catenulispora acidiphila DSM 44928
MGTAHDYLRTVMNRARVPMEPIGLEPDWGDKPRHLKYYPDAERLPLPMESVPTPDPAGDQSGNQRGDQPG
GFSVPLLADMLRHSYGYLGRRLAPHANNDLVTLPDYADANWWRGTASGGGLYPVSVYWASGARGPVLPGL
YHYSPPHHEMRRLLTGDVTAEIRAALGDAPQSVPTDTDQFLVLGLKFWQNAFKYQNFCYHAVTMDVGTIL
QSWQMFLADHGLHLTPAFWFDDRRLGDLLGVPPEQEGVFAVVPLPWTGPVVKTGENPEYPPRVRLSEQER
SRRVRTFDLNIAVHQATMTPAPRPEPPALDPAAAHRPPEDRPVVDLPEPLPPAPARQAFRARRSSFGRFS
GAVPTTGAELAAILAAASQAAAFACDVAEPERGLELAKFYVFVNHVRGVAPAAYEYDPAANRLLRVTDRS
PADFLQPTYFLENYNLEEAGAVIVPSVRADALYDSVGDRGYRLVNAVVGAIAQAVYLASAGLGLGCGAAL
GFDNPAYVEELGLEGTDEAPLLILMVGRERERPADFRYEIG