Home 

Gene Symbol:  
Caci_4207
Organism:  
Catenulispora acidiphila DSM 44928
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
4768114..4770000 [-1], 1887 bp
Product Function:  
hypothetical protein
Product Locus:  
 YP_003114912.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosG in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:1887 bp
>Caci_4207|ThioFinder303 Catenulispora acidiphila DSM 44928
GTGCTCCCGTGGGCGTCCGCCTGCGCCCGCTTCGAAGAAGGGCTGCGGCAGCGGACCGGCTTGGACGCCG
TCGTCGCGCCGCTCGGCGTGCGGGACGAGTTGGACGGCCCGATCTCCGCCCCCGAAACCAGCAGCGGCAT
GGACAACAGCTCGATCCCGCTCCACTTCACCGGACGCCACATCATCGCCGGACCGCTCGGCGAGCAGTCC
TGCGCACGCTGCCTGGCCCGGCGCTGGCAGCGGATCCGGGACCCCCTGGTCCGCGACGCGCTGGAGATCG
GCGGTCCCACGCACGCCGCCGGAATGCCGCCGCAGCTCACCGACTTCGCGCTCGACGCGACCGCCGCGCT
GCTCCTGCACTTGATCGACGAGGCGCCGAGCACCGGATCGAGCACCGCAGAGCCCTTCGTCTACCAACTC
GATCTTGTCGAAGCCAGGATCCTGCGAACCCAGGTAATGGCCGATCCGGACTGCCCGGACTGCCGCAGCC
ACGCCAGTTGCGACAACCAGACCGGTCGCGCCAACCAGACCGCCTGGACACCGATCGCCGATCTGCCGCC
GGCTCCGCGCTCCAAGCCCGGCTCGTCCCGGGTCCGGGACGCCGACGCCTTCGACCTGCCGGCCGACGCG
CTGGTCAACCCGGTGTGCGGGGTGCTGGGACAGGTGAAGATCGAGGAGCTGGACCTGCCGACCACGTCCT
CGGTCCTCGGCGTCATCGCCGAGCGCGCGGGCGGCCGGCTGTACGAGGTGTTCTGGGGCGGGCATCGCGA
CACCTATCGTCGAAGCCTGCGAACCGGGGTCCTGGAGGGCTTCGAGCGCTACGCCGGGCTGCGTCCGCGC
GGCCAGGAACCGCCGCTGGTCGCCGCTTTCGACGACCTCACCGTGCCGGCGCTCGATCCGCGCGACTGCG
GCATGTACGCGCCGGAGTTCTACGAACAGGACCCTGAGACCAAGGCGTTCGCCACGGACCGCAAGATCCC
TTGGGTCCGCGGGTACTCGCTGCGGGACGACCGCGAGATCCTGGTCCCGCTCGTCATGAGCTACTACCAC
TGCGAGCCGCACGCCGAGCGCTTCGTGCAGCAGTGCTCGAACGGCTGTGCCTCTGGAGGCTCCGTCGCCG
AAGCCGTCCTGTCCGGACTGCTGGAGCTGATCGAACGCGACGCGTTCCTACTGACGTGGTTCGGACGCCA
GAGCTTGCCCGAGCTCGATCCCCGCACCAGCGAGCACGCCGAGACCAGACATCTCGTCGAGCGCCTGGCG
ATGTACGGGTACGAAGCAAGGTTCTTCGACACCCGCCTGGCGTTCCCGGTCCCGGTCATCACCGCGGTCG
CGGTACGCCGCACCCCAGGTCTGGGCGCGTTGTGCTTCGGCGCGGGCGCCGCCCTCGACCCGGAGGAGGC
GCTGGCCGCCGGGCTGGCCGAGATCGCCACCGACGCGCTGCACGCCCGGCGCCGAGCCGAGCGCGACGAA
GCCGAGCTGCGGGCGATGGCAGCCGATTTCACGCAGGTCATCGGGCTGCACGACCACTCCCGGCTCTACG
GACTGCCGGAGATGGCGCAGTATGCCTCCTTCCTGCTCGACGCGCCGCGCGCCGCTCTACTGCCGCTGAA
GCAGGCGTTCGGTGAAGCGCCGCCGCGTACCGGCGACCTGCGCGAAGACCTCGCCGCATGCGTCGGGCAC
GTCACGGCGGCGGGCTTCGACACGATCGTCGTCGACCAGACCGCGCCCGAACAGCGCCGCCTGGGTCTGT
CCACGGTCGGCGTGATCGTGCCGGGGCTCGTGCCGATCGACTTCGGCTGGACCCGGCAGCGCGCGCCGCT
GATGCCGCGCCTGCACGCCCTCACCGGCGCCACGACGCCGAACCCCGCTCCGCACCCCTTCCCCTGA
 Primer design

Protein Sequence:628 a.a.
>Caci_4207|ThioFinder303 Catenulispora acidiphila DSM 44928
MLPWASACARFEEGLRQRTGLDAVVAPLGVRDELDGPISAPETSSGMDNSSIPLHFTGRHIIAGPLGEQS
CARCLARRWQRIRDPLVRDALEIGGPTHAAGMPPQLTDFALDATAALLLHLIDEAPSTGSSTAEPFVYQL
DLVEARILRTQVMADPDCPDCRSHASCDNQTGRANQTAWTPIADLPPAPRSKPGSSRVRDADAFDLPADA
LVNPVCGVLGQVKIEELDLPTTSSVLGVIAERAGGRLYEVFWGGHRDTYRRSLRTGVLEGFERYAGLRPR
GQEPPLVAAFDDLTVPALDPRDCGMYAPEFYEQDPETKAFATDRKIPWVRGYSLRDDREILVPLVMSYYH
CEPHAERFVQQCSNGCASGGSVAEAVLSGLLELIERDAFLLTWFGRQSLPELDPRTSEHAETRHLVERLA
MYGYEARFFDTRLAFPVPVITAVAVRRTPGLGALCFGAGAALDPEEALAAGLAEIATDALHARRRAERDE
AELRAMAADFTQVIGLHDHSRLYGLPEMAQYASFLLDAPRAALLPLKQAFGEAPPRTGDLREDLAACVGH
VTAAGFDTIVVDQTAPEQRRLGLSTVGVIVPGLVPIDFGWTRQRAPLMPRLHALTGATTPNPAPHPFP