Home 

Gene Symbol:  
Strop_2432
Organism:  
Salinispora tropica CNB-440
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
2728948..2730015 [-1], 1068 bp
Product Function:  
hypothetical protein
Product Locus:  
 YP_001159257.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosD in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:1068 bp
>Strop_2432|ThioFinder355 Salinispora tropica CNB-440
ATGACCGCGTCCGCCGCCGCGCCCGCCAACGCCGAGGACACCGGCGACCGGCGGGGACAGTGGATCGCGC
TGCACATCTTCTACGCGGCCAACCCGCAACCGTTGCTGGTGGACTGCGTGGCGCCGCTCATCCGGGAACT
CACCGAGCAGGATCTGCTCGCCGGCCACTTCTTCATCAACTACTGGCTGGAGGGGCCACACGTGCGGCTG
CGGCTACGCCCGCGTACCCCGGCCGACGAGCCGGAGGTACGGGCGCGCGCCGAGGCGGCGATCAGCCGGT
TCCTCGCCACCCGCCCCGCGCTGTACGCGATGGGCACCGGCTACCTGCGGGAGCTCTACGACATCCTCTT
CGCGCTGGAGTTCCCCGAGGGGCGGCCGGCGGAGCTGGTCGACGCGAACGGACAGATGTTGCTCAGACCC
AACAACTCCTACCACTACCGGCCCTACGAACCGGAGTACGGCAAGTACGGCGGACCGGCGGGCATCGAGG
TCGCCGAGTGGCACTTCCAGCACTCCAGCGACACGGTGCTACGGGCCATCTCGTCGATGAACCTGCACCT
GCGTCCGGTGCTGCTGGGCACCGCCGCGCAGCTGATGACGGTGCACGCCGGCACCTTCCTGCCCGACCGG
GAGCAACTGGTGGACTTCCTCGACCGGTACCACCACTACTGGCATCGGGCCTTCGCCGGCACCGACCTGA
TCGGTATCGACGAGTACACGCGCATGTACGACAGCGTCGCCGGGGAGCTCGGCCGTCGGGTACGGCAGAT
TCTCACCCTCGTCGCGCAGGGCGAGACGCGACGACTCCCCGGCTTCCTGCGCGGATGGGCCGAGCACACA
GCCCAGCTCCGCGAGAAGGTGCTGGCCCTGGCCACCTCCGGCGAACTCACGGTCAGCGCGTGGAGCGGCG
GCGACCGGGTGCTCACCGACCCGGGAGAGGCCCTCACGTTCCTGCTCTCGCCGTACCTACACATGACCAA
CAACCGGCTGCACGCCACCATCCGCGACGAGGCGTACCTCTCCTATCTGCTCGCCCGGGTGCTGCGGGAG
TCGGTGGTGTCGTCGTGA
 Primer design

Protein Sequence:355 a.a.
>Strop_2432|ThioFinder355 Salinispora tropica CNB-440
MTASAAAPANAEDTGDRRGQWIALHIFYAANPQPLLVDCVAPLIRELTEQDLLAGHFFINYWLEGPHVRL
RLRPRTPADEPEVRARAEAAISRFLATRPALYAMGTGYLRELYDILFALEFPEGRPAELVDANGQMLLRP
NNSYHYRPYEPEYGKYGGPAGIEVAEWHFQHSSDTVLRAISSMNLHLRPVLLGTAAQLMTVHAGTFLPDR
EQLVDFLDRYHHYWHRAFAGTDLIGIDEYTRMYDSVAGELGRRVRQILTLVAQGETRRLPGFLRGWAEHT
AQLREKVLALATSGELTVSAWSGGDRVLTDPGEALTFLLSPYLHMTNNRLHATIRDEAYLSYLLARVLRE
SVVSS