Home 

Gene Symbol:  
Strop_2433
Organism:  
Salinispora tropica CNB-440
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
2730012..2732762 [-1], 2751 bp
Product Function:  
lantibiotic dehydratase domain-containing protein
Product Locus:  
 YP_001159258.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosE in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:2751 bp
>Strop_2433|ThioFinder356 Salinispora tropica CNB-440
GTGCGCGCGCCGGGCCCGCCACCGTACACCGCGACGCCCGCGGGCTGGCGTACCGGTGCATACTTCACCG
CCCGGATCGCTGGTCTGCCCCTATCCACGGTCGACGCGCTCCGCTCCCCGGCAGCCTGCGCCTGGGCCGA
CCGGGCACTGGCCCTGGAGCACCAGCTCAGCACCGACGGCGCGCAGCTCAGTCAACTTCTGTACGAGCTG
GTCAACGACAATGAGGACGAGTCGGTCCGACGTCGGCTGCTGACGCTACGCCGCCAGGTCTTCAACAACG
CCCTGCCGGCCGCACCTGAGCCGGCGCTTGCCGCGGTCGAGCAGACCCGGCCGGTGGCCCTACCGGTCGT
CCAGCGCTGGATACGGCGACGCACGCAGCTCGCCCGGCATCATGACGAGGGCGGTGCGATCCTCGCCGCC
GACGTCGCCCAGGCGCGCGCCCAGCTGTGGCAGCTGGCCGACGAGCCACGCCTGCGCGGCGGGCTCCAGC
TCGCCTCACCGACCCTTGATGAGCAGCTCGCCGCCGGTAGCGCACCGGAGCTGACCCGGCCCGCGAACAA
ACGGACCCGTCGCGTCGAGCGCTCGCTGCTGTCCTACCTGTACCGCACCGCCTGCAAGACCAGCCCGTTC
AGCACCTTCACCGCGATCGCCCTCGGCCGCTTCACCGATACCGGATCGCAGCTCGAGTTTCCCGTCAACG
AGCAGTGGCACCAGCACGTACGCCTCAACGTCGTTCTGGTCGCCCGGCTTGCCGAGCTGGTCATCGCCGA
CCCGCGGCGGCGTGGCGACCTGGTGGTGGAGCTGAGCCCGGGGTGGCGCCGAGACGCCGACCGGATCCGC
TACGTGCGGCACTGGGTCACGGCCGGCGATGACAGCGCCACGGTCAGTTTCGACTCGGTCCGCGACGGAC
TCTTCTTCCTGCGCCGCAGCGGCGTCCTGGACGGGCTCACCGCCCTGTTGCAGCAGCGCGGCACGATGCG
CTGCGCCGAGCTGGTGGACCGGCTCTGCCGGGACACCGGGGCCCATCGGTCCGACGGCGAGACGTACCTG
TCGACGCTGCTGGAGTTGGGAATGCTGCGGCTGGTCGGCCTCGACACCGACGTGCACGCCCCGGATCCGA
TCCGCGCGCTCGCCGACACACTGGGGCACCTGGACACCTTGTGGGCCCGACAGCTCGTCGACCAGCTCCA
CGACGTCATCGAGCTGGTCGACGCCTACCGGCAGGGCGACCTCGGTCCGCGTCGCGACCTGCGACACCGA
CTACGGGCCACGGTACGCGCGGTGATGCGGTCCCTCGGCGAGACGAACCCGACAATGCCGCAGACGCTGC
TGTACGAGGACAGCCGGGTCGCCGGCGAACCCGTCGCCATCGCGGCCCAGCCCTGGCAGCGGCTGGTCGG
GGCGAACCTCGCCGCCGTGGAACGAGTTCTGCCCGCCTTCGACCAGAACCTGCCGCACCGGATCATGTTC
CACGGTTTCTTCCTGGCCCGGTTCGGCGTCGGTGGCCGCTGCGACGACCTGCTGCGGCTGGTCGAGGACT
TCCACGACGACCTCTACGACCAGTACTCCTCGTACACCGCGGGTCGCCGCCCGTTCGCCGACGACGGTAG
CTACACGCCGGAGGAGAACTGGCTGGGCCGGCCCGAGATGACCGCGCTCGACCAGGCCCGACAGCTCTTC
GCCACGCGGGTGGCCGCGCTCACCGACGCCGACCCCCGGTGCACCGAGCTGTCCCTGCCCGTCGAGCTGT
TCGACGAGGTGGGTGCGCTGCTCGGTGACACCGCCCACCAGGTCCACCCGATGGGGCACTTCGTCCAGTT
GGCGCTCCGCGAGCCCGACCCGCTGCTGGTACTCAACCAGTCCTTCGGAGGACTCTCCTTCCCGTTCAGC
CGGTTCACCCACTGTTTCGACGCCGACACGCCCACCCTCGCCGAGCGGTTACGAGCCCAGGCGGCCGAAC
TCAGCCCACCGGACGTGGTCTTCGCCGAGCTGACCGGGGGAGCCGCCACCACCAACCTGAACCTGCACGC
CCGGCTCACCGACTACGTTGTCGTGTGCCCCGGCGAAACCAGTAGCGTCCCGGCCGACCGGCAGCTCACC
CTCGACGACCTCTACCTGGCACACGATCCGGAAACCGACCGGGTCGTACTGCGGTCGACCCGCCTCGACA
AGGAGGTCGTCGCCGTGTACCTGGGCTACCTGGTGCCGATGGCGCTGCCGCAGATCCCGCGTACCCTGCT
GCTGCTCTCGCCGGCGTCGCTGGTGCGCCTTGACGTGTGGCGCGGGGTGCCGGCGGCAACCATCGACGGC
GTCACCGTCCGGCCCCGGCTGCGCCTCGGCAACATCGTGCTCAGCCGCCGCAGCTGGGCGGTGCCGGTAC
GCGAGCTTCCCGACCCGGGCGACCCCGGCACCGACCCGATGGCGTTCCTGGGCTGGCGTCGGTGGCGGGC
CCGGCACGGCCTGCCCGAGCAGGTGTTCGCCACGGTCTACCCGGCTACACCGGGTCGGCTGACGGCCAAC
CCGAAGCCGCAGTACGTCGACTTCGGTAGCGCGCTGTCGATGCAGGCATTGCGTGCCGTACTGAGTGATC
CGGACGACCGGCTCGTCCTGCGCGAGTTGCTGCCGGCCGCGGATGAACTGGCCGCCCACAGCGCGCTCGG
TGGGCACGTCAGCGAGCTGGCTGTGGAGACCTTCCGCGTCGACGCGAGGCAGACCGTCGCCGCACCACGA
TCAGGAGGTGGTAGCCGATGA
 Primer design

Protein Sequence:916 a.a.
>Strop_2433|ThioFinder356 Salinispora tropica CNB-440
MRAPGPPPYTATPAGWRTGAYFTARIAGLPLSTVDALRSPAACAWADRALALEHQLSTDGAQLSQLLYEL
VNDNEDESVRRRLLTLRRQVFNNALPAAPEPALAAVEQTRPVALPVVQRWIRRRTQLARHHDEGGAILAA
DVAQARAQLWQLADEPRLRGGLQLASPTLDEQLAAGSAPELTRPANKRTRRVERSLLSYLYRTACKTSPF
STFTAIALGRFTDTGSQLEFPVNEQWHQHVRLNVVLVARLAELVIADPRRRGDLVVELSPGWRRDADRIR
YVRHWVTAGDDSATVSFDSVRDGLFFLRRSGVLDGLTALLQQRGTMRCAELVDRLCRDTGAHRSDGETYL
STLLELGMLRLVGLDTDVHAPDPIRALADTLGHLDTLWARQLVDQLHDVIELVDAYRQGDLGPRRDLRHR
LRATVRAVMRSLGETNPTMPQTLLYEDSRVAGEPVAIAAQPWQRLVGANLAAVERVLPAFDQNLPHRIMF
HGFFLARFGVGGRCDDLLRLVEDFHDDLYDQYSSYTAGRRPFADDGSYTPEENWLGRPEMTALDQARQLF
ATRVAALTDADPRCTELSLPVELFDEVGALLGDTAHQVHPMGHFVQLALREPDPLLVLNQSFGGLSFPFS
RFTHCFDADTPTLAERLRAQAAELSPPDVVFAELTGGAATTNLNLHARLTDYVVVCPGETSSVPADRQLT
LDDLYLAHDPETDRVVLRSTRLDKEVVAVYLGYLVPMALPQIPRTLLLLSPASLVRLDVWRGVPAATIDG
VTVRPRLRLGNIVLSRRSWAVPVRELPDPGDPGTDPMAFLGWRRWRARHGLPEQVFATVYPATPGRLTAN
PKPQYVDFGSALSMQALRAVLSDPDDRLVLRELLPAADELAAHSALGGHVSELAVETFRVDARQTVAAPR
SGGGSR