Home 

Gene Symbol:  
Strop_2434
Organism:  
Salinispora tropica CNB-440
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
2732771..2734387 [-1], 1617 bp
Product Function:  
hypothetical protein
Product Locus:  
 YP_001159259.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosF in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:1617 bp
>Strop_2434|ThioFinder357 Salinispora tropica CNB-440
ATGACGTCCGAGAACCCCGGCTCCGCCCACGCGTACGCGACCGCGATCCTGCATCGCAGCCGTGCACCGA
TGCCTCCGGCCGACTTCGCGCCCAACTGGGCCGACGCGCCCCGCCGCGGCAAGTACTATCCGCAGGCGAG
CGCCTTCGGGCTGCCCACCCCACCGAGCACGGGCGTCGACCTGGACACCGCGCTGCGTGGTCCCGGCGAC
GTTGACGAGCCGTTCACGCTTCCGTTGCTGGCCGGCCTGCTCTATCACTCGTACGGGCTGCTCGGACGGC
GGCTCGGCATCCAGGCCAACTCCGATCTGGGCGTGCTGCCGTCGTACGCCTACGCCAACTGGTACCGCGG
CGCCGCCTCCGGCGGAGGTCTCTACCCGTGCAGCGTCTACTGGGTGGCCGGACCCGGTGCCGGGGTCACC
CCGGGTGTCTACTACTACGCCCACGCCCGGCACGCGATGCAGCGGCTGCTCGGCGGCGACGTCAGTGCTC
GGGTGAACGCGGCGGTCGCCCCACCCCACCACGCCAGCCAGTTTTTGATCGTCGGGGTGAAGTACTGGCA
GAACGCCTTCAAGTACAACAACTTCTCGTACCACGTGGTATCGATGGACCTTGGCACGCTGCTACAGGCG
TGGCGGCTCTGGGCCGGCGCCCAGGGCCGTCAGATCCGGCCCGTGCTCTGGTTCGATCAGGCGGCCGTCG
CCGACCTGCTCGGGCTCGCCCCCGACGACGAGACGCTCTTCGCCGCCGTGCCCCTGACCTGGGCCGAGCC
CACGCCCCCCGCATCCCTGCCTGCCGGGCCCACCGCGCCCGCAGGTCGGGGGGAGCCGGCAACGGTCCGG
GTACGGCACCATGACCAGGAACGGTCCCGGACGCTACTCGACTTCGATGCCCTGCGGCGGGTCAGCCGTA
GCACCGCCGCGTCGGTCGAACGGCCGGCCATCGGCGCGCTGGCATCCGCCGCCGCCCACCCGGCGCCGCC
GGGCGGAACGCGCGTGCCGCTACCCACCGCCGCGCCGCTGACGCTGCCCGTCGAGGCGGCCCTCACCGCC
CGCCGCAGTAGCTTCGGCCGGTTTCTACGGAACCGTCCCATGGCGGCGGAGCACCTCGCCGCGCTGCTGG
AGGCTACCGCCGCCAGCATGGTGCCGTCCGAGATCGAAGGTCCCGCCGACAGACCACTGGCGCGGATCTA
CGCCTTCGTCAACGCCGTGGCTGCCGTGCCCGCCGGAGGGTACGCGTACGACCCGCAGGAGCACAGCCTG
ATCCTGGTCACCAGCGGCCCACCCGGGGCGTTCCTGCAACGCAACTACACCCTGACCAACTACAACCTGG
AGCAGGCAGCGGTCGTCCTTGTCGCGACAGTTCGTACGCACGCGGTGTTGGACGCCACCGGTGACCGGGG
CTACAACCTCGCCAACGCCACCATCGGCGCGATGGCCCAAACCTTCTACACCGTCGCCGCCGCGCTGTGT
CTCGGCGCCGGGGTCGCGCTGGGCTTCGACGGCGTCTCCTACGTCGAGGAGCTAGGACTCGCCGACAGCG
ACGAATTCCCGCTGCTCATCATGCTTGCCGGCGAGGAGCGCGGGCAGCTCGGCAACTACCGATACGAGCT
GCGGTGA
 Primer design

Protein Sequence:538 a.a.
>Strop_2434|ThioFinder357 Salinispora tropica CNB-440
MTSENPGSAHAYATAILHRSRAPMPPADFAPNWADAPRRGKYYPQASAFGLPTPPSTGVDLDTALRGPGD
VDEPFTLPLLAGLLYHSYGLLGRRLGIQANSDLGVLPSYAYANWYRGAASGGGLYPCSVYWVAGPGAGVT
PGVYYYAHARHAMQRLLGGDVSARVNAAVAPPHHASQFLIVGVKYWQNAFKYNNFSYHVVSMDLGTLLQA
WRLWAGAQGRQIRPVLWFDQAAVADLLGLAPDDETLFAAVPLTWAEPTPPASLPAGPTAPAGRGEPATVR
VRHHDQERSRTLLDFDALRRVSRSTAASVERPAIGALASAAAHPAPPGGTRVPLPTAAPLTLPVEAALTA
RRSSFGRFLRNRPMAAEHLAALLEATAASMVPSEIEGPADRPLARIYAFVNAVAAVPAGGYAYDPQEHSL
ILVTSGPPGAFLQRNYTLTNYNLEQAAVVLVATVRTHAVLDATGDRGYNLANATIGAMAQTFYTVAAALC
LGAGVALGFDGVSYVEELGLADSDEFPLLIMLAGEERGQLGNYRYELR