Home 

Gene Symbol:  
Strop_2435
Organism:  
Salinispora tropica CNB-440
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
2734397..2736289 [-1], 1893 bp
Product Function:  
hypothetical protein
Product Locus:  
 YP_001159260.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosG in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:1893 bp
>Strop_2435|ThioFinder358 Salinispora tropica CNB-440
ATGAGCGACGGCGCGGCTGCGACCGACGAGTTGGTTTGTTCCGGTCTGGCCCGGCTGCTTGCCGAGCGGG
GCTGCGACGCGGAGGTGGTCGCGCTGGGGGTGCGGGACGAGTACCGGGCGTCCGCCCGCCCGGAGCGCGG
ACCGCGGGTGCTGCTCTACGGGCAGCTTGCGCTGATCGGACCGGTGCCGCCGGCAGCGGCCTGTTCGACC
TGCCTCGCGCGTCGCTGGCAGGCCGTGCGCCACCGCGACCTGCGCGACGCGGTGGAGCTGGGCGGTGACA
CGATCGCGGCGGGCCCCTGGCCGTACGCGACCCCGCTCGTCGCGGACTTCCTGCATGCGCTGATCGCGGC
GCGCCGCACCACCGACACCGGACCGGCCAGCACCGGGACGGGGGCGCCCAGCACGGTGTTTCAGGTCGAC
CTGTCGACCCTGCGGGTGCACCAGGTGCCGCTGCTGCCCGATCCCGAGTGCCCGGGCTGCGGTGACATGG
TCGCCGACGCCTCGGAGCTGGCGGTGATTGGGCTGCCCGCCACACCGAAGGCGGAGTCAGGCACATTTCG
TGGCCGGGACCTCGACGACTATCCGCTGAACGTGGCGGCGTTCGCCAACCCGGTCTGCGGGGCGCTCGGC
GGCAGTCTGTGGCAGGACGTCACCTCGCTCTCCACCTCCCCGGCGGTCGGCTCGTTCACCCTGCGGTGTG
GCCGCTTCCTGCGGGAGACGCTCTACGGTGGGCACGCCGACGGCTACCGGAGCAGCTCCCGGATCGCGGT
GCTGGAAGGATTGGAACGCGCCGCCGGCCTGCGCCCGCGGGGCAAGCGCACCGCGGTCACCGCCACGCTG
CGGGAGCTGGGCGACGACGCCCTGGACCCACGCGAGTGTGGGCTCTACACCGACGCCTTCTACCAGGCCA
ATCCGTACCTGCACCGGTTTGATGTGGATCGGCCGATCACGTGGGTGTGGGGCTGGTCGCTGCGCGACCA
GCGCACGCTGCTGGTACCGGAGATACTCGCCTACTACCATGCGGCGAGCGTCGAGGAACGCTTTGTCCAG
GAGACCTCGAACGGCTGCGCCTCCGGCGGATCCATGGTGGAGGCGATCTACCACGGGCTGATGGAGGCGG
TCGAGCGCGACGCGTTTCTGCTGTCCTGGTACGGCGGCCGGTCCCTACCAGAGATCGACCCGGCCAGCAT
CGACCGACCACGAACCCGGATGATGGTCGACCGGCTGGCGATGTACGGCTACCGGGCCCGATTCTTCGAC
ACCCGGATGACCTTCGACATCCCGGTGGTGACCGCGGTGGCCGTCCGCAGGGACGGCGGTCTCGGTACCC
TCGCCTTCGGCGGCGGGGCGAGCCTCGATCCGCAGGTCGCGATCACCGCGGCGCTCTGCGAAATCGCCAC
CGACTCGGTGATGGTCCGGGTTCGTGCCCGCGCCGACGAGCCCCGGTTGCGTCGGATGACGACCGACTTC
TCCCGGGTGCAGGGCCTGCACGACCACCCGCTGCTCTACGGCCTGCCGGAGATGGCGCGGCACGCCGCGT
TCCTGCTGGATCACGGCACCGCGCTGGCCCCGATGGCGCACCTGTACGAGCGGGACCGTCCCGCCCCACC
GGTCAGCACCGACCTGCGCGACGACCTCGAACGCTGCCTGAAGCAGGTGACGGCGCAGGGCTTCGACGTG
ATCGCCGTTGACCAGACCACCCCGGAGCAGCGCGATCTGGGCCTGACGACGGTGAGCGTGGTGGTTCCGG
GGCTCCTGCCGATCGACTTCGGCTGGCTGCGCCAGCGCGCCCCGCACGCGCGGCGGCTGCGGACCGCGTT
CCGCACCGCCGGGTTCCTCGACCGCGACCTGCGCGACGACGAAATCCACTCCGTTCCCCACCCGTTCCCG
TGA
 Primer design

Protein Sequence:630 a.a.
>Strop_2435|ThioFinder358 Salinispora tropica CNB-440
MSDGAAATDELVCSGLARLLAERGCDAEVVALGVRDEYRASARPERGPRVLLYGQLALIGPVPPAAACST
CLARRWQAVRHRDLRDAVELGGDTIAAGPWPYATPLVADFLHALIAARRTTDTGPASTGTGAPSTVFQVD
LSTLRVHQVPLLPDPECPGCGDMVADASELAVIGLPATPKAESGTFRGRDLDDYPLNVAAFANPVCGALG
GSLWQDVTSLSTSPAVGSFTLRCGRFLRETLYGGHADGYRSSSRIAVLEGLERAAGLRPRGKRTAVTATL
RELGDDALDPRECGLYTDAFYQANPYLHRFDVDRPITWVWGWSLRDQRTLLVPEILAYYHAASVEERFVQ
ETSNGCASGGSMVEAIYHGLMEAVERDAFLLSWYGGRSLPEIDPASIDRPRTRMMVDRLAMYGYRARFFD
TRMTFDIPVVTAVAVRRDGGLGTLAFGGGASLDPQVAITAALCEIATDSVMVRVRARADEPRLRRMTTDF
SRVQGLHDHPLLYGLPEMARHAAFLLDHGTALAPMAHLYERDRPAPPVSTDLRDDLERCLKQVTAQGFDV
IAVDQTTPEQRDLGLTTVSVVVPGLLPIDFGWLRQRAPHARRLRTAFRTAGFLDRDLRDDEIHSVPHPFP