Home 

Gene Symbol:  
Strop_2436
Organism:  
Salinispora tropica CNB-440
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
2736286..2738469 [-1], 2184 bp
Product Function:  
hypothetical protein
Product Locus:  
 YP_001159261.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosH in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:2184 bp
>Strop_2436|ThioFinder359 Salinispora tropica CNB-440
ATGAGCACTGCATACGACACGGTGGCGCAGACCCGACCGCGAGTGCGCCACGACGTGCTGTTCACCAGGA
CCGAGGACGGAGTGTTGTTCCACAACGCCACCAGCGGCTTCCGGCTCTCCTCCACGACCGCCTACCGGCT
GGCATCGTTGCTCATCCCGCATCTGAACGGGCGTCATCAGGTCGCGGACATCTGTGCTCGGTTGCCCGCC
GGGCAGCGGGCCATGATCGGTGAGCTGGTGAGCACCCTCTACGCGCGCGGCTTCGCCCGTGACGTTCCCG
AGGCGGAGGTCGACCCGACGACGATCCTCGGTCCGGCGGTGGCCGCGCATTTCGCCACCCAGGTCGCCTA
TCTCGACCACTACACCGACCGGGCGGCGCAGCGCTTCGCCACCTTTCGGAACACCTCGGTCGCGGTGCTG
GGCGCCGGCCCGGTCGCCACTGCCTGCGCCACCGGGCTCCTTCGCAACGGCGCCGCCACGGTAGCCGTCT
CGCCGGCAGTCGTACCGAGGCTCACCCCGGAGCTGGCCGAGCCGAACGCCGCGGGCTGCGCCGCGACGAC
CGTGCCGCTACCCGACGCGCGCACCGAGGTCGGCTGGTCCGCGCTGGCCACGGCGGAGATCGTGATTGTG
GCCGGCGGAGATGACGCGCCCCGCGACACCCTGCGGCTACTCGCGGCCGGAATTCCCCCCGGCCGGCTTC
TCCTGCCCGCCTGGGTCGCCGGTGGGCGGATGCTGGTCGGCCCGGTCCAAGGCGTCGGCCGTACCGGATG
CTGGTGCTGCGTCATGCTGCGGCTGGCCGACAACGACGAGACCGGGGGCGCCGGCCGGGTGTGGCAGGCG
GCGGCGTTGCCGTCCGGGGCCGCCCCCGCCGCCGTCGAGCCGGACGGACCCCTCGCCGCGATGATCGGCA
ACCTGCTGGCGTACGAGGTGTTCCGGCTGACCACCGGCGCGCTGCCCGCCGAGACCGACGGGAGCGTGAT
CGTGCAGCACCTCGCCTCACTCGACGTGCTGACCGAGCAACTGCTTCCGCACCCCCGGTGTACCTTCTGC
CGGCCGGCCCCACCCGAACCGGCCTGGATCACCGGTGGGCTGGACGACCCGCCCGTCGGGGCCGATCCCG
CGGCCGGCCCGGCCGCTGGGGCACAAGACGCGCTCGCACAGTTGGAGGCCCATCAGCCGCTACTCCAACC
GCATCTGGGTGTGTTCCGCCGCTACGACGACGAGCGTTGGGACCAGACCCCGATCAAGGTCGGCGCGGTC
GAGTTCACCGACGGCAGTGGCCAGCGCCGTACGGTGGCGGCCTTCGACGTCCACCACGTCGCGGCGGCCC
GACTGCGGGCGCTACGGATCGCGGCCGTCGTCAACACCAGCAGCGTCGCGACCGGCATCCCCACCCCCCA
CGACCGTCCACGGCTCGACGCCACCCGCCTCGGTCTCGCCTCGGGCTGGGATGACGCCGCGCCAGACACG
TGGGCCACCGCCCGGTCACTGTTCACCCGCGAGGTGGTGGCGGTGCCGGTGTCCGTACTGGAGCCGTTCG
GCGCGGCCAACCGCCGGCACGGTGTCGAGCCGACCAGTGCTGGCGGGGGAGCGGGCGGTGATCTCACCGA
GGCCGTCCGGGCGGGCCTCGCCTCGGCGCTCGCCGGGCAGCGGCTACGGCAGGTCGTCTTCGGTCAGGAG
ACCGTCCAGAAGATCCGCTTCAACACCATCGGCGCCACCACCCCCGAGCTGCTGTTCCTCACCAGGTCGA
CGGCGAACCTGGGTGTCACCATGGAACTGCTCGACCTCGGTGGACAGCGCGACACCGGGGTGGCGGTGCT
GCTGGCCCGCTCCTTCGACCCAGGCCGCGGTCAATGGACGTACGCGTTGACCGCCGATCCGGACTGGACG
GCGGCGGCCGTGGCGGCGCTGCGTGACGTGCTCGGTCAGGCCCAACTGCGTGCACAGGACCCCGAGGTCG
TACCGGACACCGGCGACCCCGTGCTGGTCGACTTCGACGCCGGCACGGTGCCGGTGCACGAGGAGGTGGA
TGCCGGCGGGGTCAGTCACCGCTGGGCCGATGTGCTGCAGCGGCTACCGGGCCTCGGGTGCGACGTGCTG
GTGGCACCCGTCGGTGGTGCGGACCTGGCCGCGGGCGGGCTGGTGGCGGTCAAGGTGCTGCTGGCCGCCA
GAGGCGACCGATGA
 Primer design

Protein Sequence:727 a.a.
>Strop_2436|ThioFinder359 Salinispora tropica CNB-440
MSTAYDTVAQTRPRVRHDVLFTRTEDGVLFHNATSGFRLSSTTAYRLASLLIPHLNGRHQVADICARLPA
GQRAMIGELVSTLYARGFARDVPEAEVDPTTILGPAVAAHFATQVAYLDHYTDRAAQRFATFRNTSVAVL
GAGPVATACATGLLRNGAATVAVSPAVVPRLTPELAEPNAAGCAATTVPLPDARTEVGWSALATAEIVIV
AGGDDAPRDTLRLLAAGIPPGRLLLPAWVAGGRMLVGPVQGVGRTGCWCCVMLRLADNDETGGAGRVWQA
AALPSGAAPAAVEPDGPLAAMIGNLLAYEVFRLTTGALPAETDGSVIVQHLASLDVLTEQLLPHPRCTFC
RPAPPEPAWITGGLDDPPVGADPAAGPAAGAQDALAQLEAHQPLLQPHLGVFRRYDDERWDQTPIKVGAV
EFTDGSGQRRTVAAFDVHHVAAARLRALRIAAVVNTSSVATGIPTPHDRPRLDATRLGLASGWDDAAPDT
WATARSLFTREVVAVPVSVLEPFGAANRRHGVEPTSAGGGAGGDLTEAVRAGLASALAGQRLRQVVFGQE
TVQKIRFNTIGATTPELLFLTRSTANLGVTMELLDLGGQRDTGVAVLLARSFDPGRGQWTYALTADPDWT
AAAVAALRDVLGQAQLRAQDPEVVPDTGDPVLVDFDAGTVPVHEEVDAGGVSHRWADVLQRLPGLGCDVL
VAPVGGADLAAGGLVAVKVLLAARGDR