Home 

Gene Symbol:  
Sare_2587
Organism:  
Salinispora arenicola CNS-205
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
2946283..2947350 [-1], 1068 bp
Product Function:  
hypothetical protein
Product Locus:  
 YP_001537419.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosD in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:1068 bp
>Sare_2587|ThioFinder388 Salinispora arenicola CNS-205
ATGACCGCGTCCGCCGCCGCGCCCACCAACGCCGAGGACACCGCCGACCAGCGGGGACAGTGGATCGCGC
TGCACATCTTCTACGCGGCCAACCCGCAACCGCTGCTGGTGGAATGCGTGGCGCCGCTGATCCGGGAACT
CACCGAGCAGGACCTGCTCGCCGGTCACTTCTTCATCAACTACTGGCTGGAGGGACCACACGTGCGGCTG
CGGCTGCGCCCACGTACCCCAGCCGACGAGCCGGAGGTGCGGGCGCGTACCGAGGCGGCGGTCAACCGGT
TCCTGACCACCCGCCCCGCGCTGTACGCGATGGGCACCGGCTACCTGCGGGAGCTCTACGACATCCTCTT
CGCGCTGGAGTTCCCCGAGGGGCGGCCGGCGGAACTGGTCGACGCAAACGGACAGATGCTGCTCCGACCC
AACAACTCATACAGCTACCGGCCCTACGCACCGGAGTACGGCAAGTACGGCGGGCCGGCGGGCATCGAGA
TCGCCGAATGGCACTTCCAGCACTCCACCGACACGGTGCTACGCGCCATCTCGTCGATGAACCTGCACCT
GCGCCCGGTGCTGCTGGGCACCGCCGCGCAACTGATGACGGTGCACGCCGGCACCTTCCTGCCCGACCGC
GAGCAACTGGTGGACTTCCTCGACCAATACCACCACTACTGGCACCGGGCCTTCGCCGGCACCAACCTCA
TCGGCATCGACGAGTACACGCGAATGTACGACAGCGTCGCCGGGGAACTCGGCCGCCGGGTACAACAGAT
CCTCACCCTCATCGCGCAGGGCGAAACCCAGCGCCTCCCCGGCTTCCTGCGCGGATGGGCCGAACACGCC
GCCACGCTCCGGCAGAAGGTGCTCGCCCTGGCCACCTCCGGCGAACTGACCGTCAGCGCCTGGAGCGGCG
GCGACCGGGTCATCACCGACCCGGGGGAGGCCCTCACATCCCTGCTCTCGCCATACCTCCACATGACCAA
CAACCGGCTGCACGCCACCATCCGCGACGAGGCGTACCTCTCCTACCTGCTCGCCCGGGTGCTGCGAGAG
TCGGCGGTGTCGTCGTGA
 Primer design

Protein Sequence:355 a.a.
>Sare_2587|ThioFinder388 Salinispora arenicola CNS-205
MTASAAAPTNAEDTADQRGQWIALHIFYAANPQPLLVECVAPLIRELTEQDLLAGHFFINYWLEGPHVRL
RLRPRTPADEPEVRARTEAAVNRFLTTRPALYAMGTGYLRELYDILFALEFPEGRPAELVDANGQMLLRP
NNSYSYRPYAPEYGKYGGPAGIEIAEWHFQHSTDTVLRAISSMNLHLRPVLLGTAAQLMTVHAGTFLPDR
EQLVDFLDQYHHYWHRAFAGTNLIGIDEYTRMYDSVAGELGRRVQQILTLIAQGETQRLPGFLRGWAEHA
ATLRQKVLALATSGELTVSAWSGGDRVITDPGEALTSLLSPYLHMTNNRLHATIRDEAYLSYLLARVLRE
SAVSS