Home 

Gene Symbol:  
Sare_2588
Organism:  
Salinispora arenicola CNS-205
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
2947347..2950106 [-1], 2760 bp
Product Function:  
lantibiotic dehydratase domain-containing protein
Product Locus:  
 YP_001537420.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosE in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:2760 bp
>Sare_2588|ThioFinder389 Salinispora arenicola CNS-205
ATGCACGTCGTGCCAGCACAGGGCCGGCTACCGCGCACCGCCGCCCCCACCGGCTGGCGCACCGGTGCGT
ACTTCACCGCCCGGGTCGCCGGCCTTCCCCTGTCGACGGTCGACGCGCTGCGCTGCCCGGCGGCCTGCAC
CTGGGCCGACGACGTACTCACCCTGGAACGCCAGCTCGCGGCCGACGGGGCACGGCTCAGTCAACTCCTG
TACGAGCTGGTCAACGACAACGAGGACGAGTCGGCCCGGCGACGGCTGCTGACGCTGCGCCGACAGATCT
TCAACAACGTCCTGCCGGCCGCACCCGGGCCGGCGCTCGCCGCGGTCGCGCAGACCCGGCCGGCGGCCCT
ACCGGTCGTACAGCGCTGGCTGCAGCAACGGACCCAGCTCGCCCGGCGACACGACGAAGGTGGTGCGGTC
CTCGCCGCCGACGTCGCCCAGGCTCGCGCCCACCTGTGGCGGCTGGCCGACGAGCCACGCCTGCGCGGCG
GACTCCAACTCGCCTCACCGACCCTCGATGAGCAACTCGCCGCCGGGACTGCACCGCAGCTGACCCGGCC
CGCGAACAAACGAACCCGCCGCGTCGAACGCTCACTGCTGTCCTACCTGTACCGCACCGCGTGCAAGACC
AGCCCGTTCAGCACCTTCACCGCGGTCGCCCTCGGCCGCTTCACCGACACCGGATCGCAGCTCGAGTTCC
CCGTCGACGCGCAGTGGCACCAACACGTACGCCTCAACGTCGTCCTGGTCGCCCGGCTCGCCGAGCTGGT
CACCGCCGACCCGCGGCGGCGCGGCGACCTGTTGGTGGAGCTGAGCCCGGGATGGCGCCGCGACGCGGAC
CGGATCCGCTACGTGCGGCACTGGGTCACCGCCGGCGACGACAGCGCCACGGTCAGCTTCGACTCGGTCC
GCGACGGCCTCTTCTTCCTGCGCCGCAGCGGCGTCCTGGACGGGCTCACCGCCCTGTTGCAGCACCGCGG
CACGATTCGCTGCGCCGACCTGGTGGACCGGCTCTGCCAGGACACCGGGGCCGAACGGCCCGACGGCGAG
ACGTACCTGTCGACGCTGCTGGAGTTGGGAATGCTGCGGCTGGTCGGCCTCGACACCGACGTGCACGCCA
CGGACCCGATCCGCACGCTCGCCGGCACGCTGCGGCACCTGGACAGGCCGTGGGCCACACACCTCGTCGA
CCAGCTCCACGACATCATCGAGCTGGTCGACGCCTACCGACAGGGCGACCTCGACCAGCGCCGCGACCTG
CGGCACCGACTCCGGGACACGGTACGCACGGCGATGCGCGCACTCGGCGAGGACAACCCGACCCTGCCGC
AGACCCTGCTGTACGAGGACAGCCGGGTCGCCGGCGAACCCGTCACCATCGCGGCCCCGCCCTGGCAGCG
GCTGGTCGGCGCGAACCTCGCCGCCGTGGAGCGGATTCTGCCCGCCTTCGACCAGAACCTGCCACACCGG
ATCATGTTCCACGGCTTCTTCCTGGCCCGGTTCGGCGTCGGTGGCCGCTGCCACGACCTGCTGCGGCTGG
TCGAGGACTTCCACGACGACCTCTACGAGCAGTACTCCTCCTACACGGCGGGGCGCCGCCCGTTCGCCGA
GGACGGTAGCTACACCCCCGAGGAGAACTGGCTGGGCCGACCCGAAATGACCGCACTCGATGAGGCCCGA
CAGCTCTTCGCTACCCGCCTGGCCGCACTCACTGCCGCCGACCCCCAGAGCACCGAGCTGTCCCTGCCCG
TCGAGCTGTTCGACGAGATGGGCGCGCTGCTCGGCGACACCGCCCACCGGATCCACCCGAAAGGGCACTT
CGTCCAGCTGGCCCTACGCGAGCCCACCCCGCTGCTGGTGCTCAACCAGTCCTTCGGCGGACTCTCCTTC
CCGTTCAGCCGGTTCACCCACTGCTTCGACGCCGACACCCCCACCCTCGCCGAGCGGCTACGTGCCCAGG
CAGCTGAAATCACCCCACCGGGCGTGGTCTTCGCCGAGCTGACCGGGGGAGCCGCCACCACCAACCTGAA
CCTGCACTCCCGGCTCACCGACTACGTGATCGTCTGCCCCGGCGAATCCAGCAGCGCCCCCGCCGACCGG
CAACTCACCCTCGACGACCTCCACCTGGCACACGATCCGGACACCGACCGGATCGTGCTGCGGTCGACCC
GCCTCGACAAGGAGGTCGTCGCCGTGTACCTGGGCTACCTGGTGCCGATGGCGCTGCCGCAGATCCCGCG
TACCCTGCTGCTGCTCTCACCGGCGTCGGCGGTGCGCCTCGACGTGTGGCGCGGAGTGCCGGCGGCCACC
ACCGACGGCATCACCGTCCGGCCCCGGCTGCGCCTGGGCAACATCGTGCTCGCCCGCCGCAGCTGGTCCG
TACCGGTACGCGAGCTTCCCGACACGGGCGACCCCGGCACCGACCCGGCGGCGTTCCTGGGCTGGCGCCG
CTGGCGGGCCCGGCACGGCATACCCGAGCAGGCATTCGCCACCGTCTACTCAGCCGACCCCGGGCGGCGG
ACGACCAACCCGAAGCCGCAGTACGTCGACTTCGGCAGCGCGCTGTCGATGCAGGCGTTGCGGGCCGTGC
TGGACGGCCCGGACGACCGGATCGTCCTGCGTGAGCTGCTGCCGGCCGCCGACGAACTGCCCGCCCACGG
CGCACACGGTGGGCACGTCAGCGAGCTGGCAGTAGAGACCTTCCGCGTCGACGCGAGGCAGACCGTCGCC
CACCACGACCACGGAGGTAGCAGCCAATGA
 Primer design

Protein Sequence:919 a.a.
>Sare_2588|ThioFinder389 Salinispora arenicola CNS-205
MHVVPAQGRLPRTAAPTGWRTGAYFTARVAGLPLSTVDALRCPAACTWADDVLTLERQLAADGARLSQLL
YELVNDNEDESARRRLLTLRRQIFNNVLPAAPGPALAAVAQTRPAALPVVQRWLQQRTQLARRHDEGGAV
LAADVAQARAHLWRLADEPRLRGGLQLASPTLDEQLAAGTAPQLTRPANKRTRRVERSLLSYLYRTACKT
SPFSTFTAVALGRFTDTGSQLEFPVDAQWHQHVRLNVVLVARLAELVTADPRRRGDLLVELSPGWRRDAD
RIRYVRHWVTAGDDSATVSFDSVRDGLFFLRRSGVLDGLTALLQHRGTIRCADLVDRLCQDTGAERPDGE
TYLSTLLELGMLRLVGLDTDVHATDPIRTLAGTLRHLDRPWATHLVDQLHDIIELVDAYRQGDLDQRRDL
RHRLRDTVRTAMRALGEDNPTLPQTLLYEDSRVAGEPVTIAAPPWQRLVGANLAAVERILPAFDQNLPHR
IMFHGFFLARFGVGGRCHDLLRLVEDFHDDLYEQYSSYTAGRRPFAEDGSYTPEENWLGRPEMTALDEAR
QLFATRLAALTAADPQSTELSLPVELFDEMGALLGDTAHRIHPKGHFVQLALREPTPLLVLNQSFGGLSF
PFSRFTHCFDADTPTLAERLRAQAAEITPPGVVFAELTGGAATTNLNLHSRLTDYVIVCPGESSSAPADR
QLTLDDLHLAHDPDTDRIVLRSTRLDKEVVAVYLGYLVPMALPQIPRTLLLLSPASAVRLDVWRGVPAAT
TDGITVRPRLRLGNIVLARRSWSVPVRELPDTGDPGTDPAAFLGWRRWRARHGIPEQAFATVYSADPGRR
TTNPKPQYVDFGSALSMQALRAVLDGPDDRIVLRELLPAADELPAHGAHGGHVSELAVETFRVDARQTVA
HHDHGGSSQ