Home 

Gene Symbol:  
Sare_2589
Organism:  
Salinispora arenicola CNS-205
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
2950106..2951719 [-1], 1614 bp
Product Function:  
hypothetical protein
Product Locus:  
 YP_001537421.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosF in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:1614 bp
>Sare_2589|ThioFinder390 Salinispora arenicola CNS-205
ATGACGTCCGAGAACCCCGGCCTCGCCCACGCGTACGCGACCGCGATCCTGCGGCGCGGCCGTGAACCGA
TGCCCCCGGCAGACTTCACGCCCAACTGGGCCGACGCGCCCCGCCGCGGCAAGTACTACCCGCGGGCGAG
CGCCTTCGGGCTGCCCGCCCCGCCGAGCGCCGGCGTCGACCTGGACGCCGCGCTGCACGGCCCCGGCGAC
GCCGACGAGCCGTTCACGCTGCCGCTGCTGGCCGGCCTGCTCCATCACTCGTACGGGCTGCTCGGACGGC
GGCTCGGCATCCAGGCCAACTCCGATCTGGGAGTGCTGCCGTCGTACGCGTACGCCAACTGGCACCGCGG
CGCCGCCTCCGGTGGAGGTCTCTACCCGTGCAGCGTCTACTGGGTCGCCGGGCCCGGCGCCGGGGTCACC
CCTGGGGTCTACTACTACGCCCACGCCCGGCACGCGATGCAGCGGCTGCTCGGCGGCGACGTCAGCGCTC
GGGTGAACGCGGCGGTCGCCCCACCCCACCCCGCCAGCCAGTTTCTGATCGTCGGGGTGAAGTACTGGCA
GAACGCCTTCAAGTACAACAACTTCTCGTACCACGTGGTGTCGATGGACCTGGGTACGCTGCTGCAGTCA
TGGCGGCTCTGGGCCGGCGCCCAGGGCCGACAGATCCGGCCCGTGCTCTGGTTCGATCAGGCGGCCGTCG
CCGACCTGCTCGGGCTCGCCCCCGACGATGAGACACTCTTCGCCGCCGTACCCCTGACCTGGGCCGCGCC
CGCCGCCCCCGCGGCCCTGGCGCCCACGTCCGCCCCCACCCGTCGAAGGGAGCCGGCGACGGTCCGGGTA
CGACACCGCGACCAGGAGCGGTCCCAGACGCTGCTCACCTTCGACACGCTGCGGCAGGTCAGCCGCAGCA
CCGCCGCGTCGGTCGACCGGCCCGCTACCGGGGCGCTGGCACCCGCCGCCGCCCACCCGACGCCGCCGGG
CGGAACCCGCCTACCGCTACCCGCCGCCGCGCCGCTGACGCTGTCCGTCGAGGCCGCCCTCACCGCCCGC
CGCAGCAGCTTCGGCCGGTTCCTGCACAATCGTCCGATGGCGGCGGAGCAGCTCGCCGCGCTGCTGCGGG
CCACCACCGCCAGCACCGTGCCATCCGAGATCGACGGACCCGCAGACCGTCCGCTGACCCGGATCTACGC
CTTCGTCAACGCCGTGGCCAACGTGCCCGCCGGGGGATACGTGTACGACCCGCAGGAGCACAGCCTGGTC
GCCGTCACCAGTGGCCCACCAGGGGCATTCCTGCAACGCAACTACACCCTGGCCAACTACAACCTGGAGC
AGGCAGCGGTCGTGCTCGTCCTGACGGTGCGCACACACGCGGTGCTGGACGCCACCGGCGACCGAGGCTA
CAACCTCGTCAACGCCACCATCGGCGCGATGGCCCAGACCTTCTACACTGTCGCCGCCGCACTGCACCTC
GGCGCGGGGGTCGCACTGGGCTTCGACGGCATCTCCTACGTCGAGGAGCTGGGACTCGCCGACAGCGACG
AGTTCCCGCTGCTCATCATGCTCGCCGGCGAGGAACGCGGACAGCTCGGCGACTACCGATACGAGCTGCG
GTGA
 Primer design

Protein Sequence:537 a.a.
>Sare_2589|ThioFinder390 Salinispora arenicola CNS-205
MTSENPGLAHAYATAILRRGREPMPPADFTPNWADAPRRGKYYPRASAFGLPAPPSAGVDLDAALHGPGD
ADEPFTLPLLAGLLHHSYGLLGRRLGIQANSDLGVLPSYAYANWHRGAASGGGLYPCSVYWVAGPGAGVT
PGVYYYAHARHAMQRLLGGDVSARVNAAVAPPHPASQFLIVGVKYWQNAFKYNNFSYHVVSMDLGTLLQS
WRLWAGAQGRQIRPVLWFDQAAVADLLGLAPDDETLFAAVPLTWAAPAAPAALAPTSAPTRRREPATVRV
RHRDQERSQTLLTFDTLRQVSRSTAASVDRPATGALAPAAAHPTPPGGTRLPLPAAAPLTLSVEAALTAR
RSSFGRFLHNRPMAAEQLAALLRATTASTVPSEIDGPADRPLTRIYAFVNAVANVPAGGYVYDPQEHSLV
AVTSGPPGAFLQRNYTLANYNLEQAAVVLVLTVRTHAVLDATGDRGYNLVNATIGAMAQTFYTVAAALHL
GAGVALGFDGISYVEELGLADSDEFPLLIMLAGEERGQLGDYRYELR