Home 

Gene Symbol:  
Sare_2591
Organism:  
Salinispora arenicola CNS-205
Gene Cluster:  
    gene cluster
Position [Strand], Length:  
2953618..2955798 [-1], 2181 bp
Product Function:  
hypothetical protein
Product Locus:  
 YP_001537423.1  [GenBank Link]
Homologue:   
(of the nosiheptide biosynthetic proteins)  
NosH in Streptomyces actuosus ATCC 25421
  
Nucleotide Sequence:2181 bp
>Sare_2591|ThioFinder392 Salinispora arenicola CNS-205
ATGAGCACTGCATACGACACGGTGGCGCAGACCCGGCCGCGAGTGCGCCACGACGTGCTGTTCACCCGAA
CCGAGGACGGAGTGCTGTTCCACAACGCCACCAGCGGCTTCCGGTTCTCCTCCACCACCGCGTACCGGCT
GGCGTCGGTACTCGTCCCGCACCTGAACGGGCGCAATCAGGTCGCGGACATCTGTGCCCGGCTACCCGCC
GGGCAACGGGCCATGATCGGTGAGCTGGTGAGCACCCTCTACGCACGCGGCTTCGCCCGCGACGTCCCCG
AGACGGAGGGAGACCCGACGGCGATCCTCGGCCCGGCGGTGGCCGCGCACTTCGCCACCCAGGTTGCCTA
CCTCGACCACTACACCGACCGGGCGCCGCAGCGCTTCGCCACCTTCCGGCACACCTCGGTCGCGGTGCTG
GGCGCCGGCCCGGTCGCCACCGCCTGCGCCACCGGACTGCTTCGCAACGGCGCCGCCACGGTGACCGTCT
CGCCGGCGATCGCGCCGAGGCTCGCGCCCGAGCTGGCCGAGCTCGACGCCGCAGGCTGCCCCGCGACGAC
CGTGCCGCTGCCCACGACCGGCAACGAGGTCGGCTGGTCCGACCTGGCCACAGCGCAGATCGTCGTGGTG
GCCGGCGGGGACGACGCGCCCCGCGACACCCTGCGGCTCCTCGCGGCCGGCGTTCCCGCCGACCGGCTGC
TCCTGCCGGCCTGGGTCGCCGGCGGACGGATGCTCGTCGGGCCGGTGCAGGGCGAAGGCCGTACCGGATG
CTGGTGCTGCGTCATGCGGCGACTCGCCGACAACGACGAGACCGGTGGCGCCGGGCAGGTGTGGCAGGCG
GCGGCGCTCCCGTCCGGGGCCGCGCCAGCCGCCACCGAGCCCGACGGACCGCTTGCGGCGATGATCGGCA
ACCTGTTGGCGTACGAGGTGTTCCGGCTGACCACCGGCGCGCTGCCCGCCGAGACCGACGGGAGCGTGAT
CGTTCAGCACCTCGCCTCACTCGACGTGCTGACCGAGCAACTTCTTGCGCACCCCCGGTGCACCTTCTGC
CGGCCGGCACCGCCCGAACCGGCCTGGACCACCGAAGGGCTGGACGAAGCGCCTGCCGAGGCCGCCTCCG
CGGCCGACCCGGCCGCGGGGGCGCAGGAAGCGCTCGCACAGTTGGAGTCCCACCAACCGCTACTCCAGCC
GCATCTGGGCGTGTTCCGTCGCTACGACGACGAGCGTTGGGACCAGACCCCGATCAAGGTGGGCGCGGTC
GAGCTCACCGACGGCAGCGGCCGGCGCCGAACGGTGACCGCGTTCGACGTCCACCACGTCGCGGCGGCCC
GGCTGCGGGCACTACGGATCGCGGCCGTCGTCAACACCAGCAGCATCGCGGTCGGGACCCCCGCCCCCCA
GGGCGCCGAGCGGGTCGACGCCGCCCGACTCGGCCTCGCCTCAGGCTGGGGCGACGCCCCGGTGCAACGG
TGGGCCACCGCCCGGTCACTGCTCAGCCGCGAGGTGGTGGCGGTGCCGATGCCCGTGCTGGAGCCGTTCG
GCGCGGCCAACCGCCGGCACGAGGCCGAGCCGACCAGCGCCGGTGGGGGAGCGGGCGGCGACCTCACCGA
GGCCGTCCGGGCCGGCCTCGCCTCGGCGCTCGCCGGGCACACGCTACGGCAGGTCATCGCCGGTCGGGAC
ACCGTCCGACGGATCCGCCTCGACACCATCGGCACCACCCCCGAGCTGGTGTTTCTCACCAGGTCAACAG
CGAACCTGGGCGTCACCATGGAACTGCTCGACCTCGGTGGACAGCGCGACACCGGGGCGGCGGTGCTGCT
GGCCCGCTCCTTCGACCCGGACCGCGGTCAATGGACGTTCGCGCTGACCGCCGATCCGGACTGGACGACG
GCGGCCGCGGCGGCGCTGCGCGACGTGCTCGGTCAGGCCCAGCTTCGCGCGCAGGACCCCGAGCTCGTAC
CAGATATCGGCGACCCGGTGCTGGTCGACTTCGACCCCGGCACGGTGCCGGTGCACGACGAGGTGGACGC
GGCCGGGGTGCGGCACCGCTGGGCCGACGTGCTGCAGCGGCTACCGGGACTCGGGTACGACGTGCTGGTG
GCGCCCGTCGGTGGTGCGGACCTGGCCGCGGGCGGGCTGGTGGCGGTCAAAGTGCTGCTCGCCGCCGGAG
ACCACCGATGA
 Primer design

Protein Sequence:726 a.a.
>Sare_2591|ThioFinder392 Salinispora arenicola CNS-205
MSTAYDTVAQTRPRVRHDVLFTRTEDGVLFHNATSGFRFSSTTAYRLASVLVPHLNGRNQVADICARLPA
GQRAMIGELVSTLYARGFARDVPETEGDPTAILGPAVAAHFATQVAYLDHYTDRAPQRFATFRHTSVAVL
GAGPVATACATGLLRNGAATVTVSPAIAPRLAPELAELDAAGCPATTVPLPTTGNEVGWSDLATAQIVVV
AGGDDAPRDTLRLLAAGVPADRLLLPAWVAGGRMLVGPVQGEGRTGCWCCVMRRLADNDETGGAGQVWQA
AALPSGAAPAATEPDGPLAAMIGNLLAYEVFRLTTGALPAETDGSVIVQHLASLDVLTEQLLAHPRCTFC
RPAPPEPAWTTEGLDEAPAEAASAADPAAGAQEALAQLESHQPLLQPHLGVFRRYDDERWDQTPIKVGAV
ELTDGSGRRRTVTAFDVHHVAAARLRALRIAAVVNTSSIAVGTPAPQGAERVDAARLGLASGWGDAPVQR
WATARSLLSREVVAVPMPVLEPFGAANRRHEAEPTSAGGGAGGDLTEAVRAGLASALAGHTLRQVIAGRD
TVRRIRLDTIGTTPELVFLTRSTANLGVTMELLDLGGQRDTGAAVLLARSFDPDRGQWTFALTADPDWTT
AAAAALRDVLGQAQLRAQDPELVPDIGDPVLVDFDPGTVPVHDEVDAAGVRHRWADVLQRLPGLGYDVLV
APVGGADLAAGGLVAVKVLLAAGDHR